Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g96.t1
Gene name
Locationscaffold_01:274170..277205
Strand-
Gene length (bp)3035
Transcript length (bp)2814
Coding sequence length (bp)2814
Protein length (aa) 938

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 3.0E-82 62 311
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 7.4E-68 558 756
PF02815 MIR MIR domain 8.4E-45 358 534

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006493 protein O-linked glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0070085 glycosylation No
GO:0036211 protein modification process No
GO:0043412 macromolecule modification No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0016758 hexosyltransferase activity No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0006486 protein glycosylation No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 100 122 22
2 142 164 22
3 193 215 22
4 230 252 22
5 289 311 22
6 612 634 22
7 655 677 22
8 717 739 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT39 3.6E-72 63 308

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4861
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g5458.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g8523.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g6502.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g2270.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g3885.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g3883.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g8096.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g7196.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g5507.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g8961.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g4632.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g3491.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g5238.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g9091.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g8231.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g1043.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g5431.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g2643.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g96.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g147.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g931.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g4631.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3913.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g9192.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g9593.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g3224.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g6328.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g223.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g1644.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g8111.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g4516.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g6050.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9460.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g6833.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g96.t1
MGQKAQDTLAVRPQSRGRRSPSRSPKPKNRKPLAVPQTYASEGVKNNDIFKLPGSDYRLIVLVTLIAAAVRLFRI
YQPTSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKLLLTLAGWLAGFDGNFDFKDIGKDYLEPGVPYVAMRMLPA
ILGVLTVPLMFLTLKVTGCRTSTSVLGAGLVIFDNALVTQSRLILLDSPLIFFTALTALAFSCFTNQQELGPAYA
FRGPWWFWLVCTGLSLGATLSVKWVGLFTMAWVGSLTALQLWVLLGDSKNVTPRLWFKHFFSRVFCLIVIPLGFY
MAMFAIHFTCLVNPGEGDGFMSSEFQATLNSKSMQDVPADVSFGSRVSLRHLNTQGGYLHSHPHMYPTGSKQQQI
TLYPHKDENNEFLLENSTQPLGPYGEVEGPFAWDNLTAPGFIEDGSIIRLYHVITHRRIHSHDERPPVTEADWQY
EVSAYGYEGFPGDANDLWRVEIVKSMSETPESKKRLRTIQSKFKLVHVMTGCVLFSHKVKLPDWGYEQQEVTCAK
GGTLPNSIWYIESNQHPAMAPDAERVNYRNPGFLGKFWELQKVMWTTNAGLVESHAWDSRPPSWPTLLRGINFWG
KDNRQIYLLGNPLIWWSTTLAIGIYFVFKALSIVRWQRSCDDYKHTSFKRFDYEVGTSVLGWFFHYFPFYLMARQ
LFLHHYLPALYFAIMVFCQEFDFLTNRIKSLGLASKPLIGKALMAVFLGLSVVVFTLYAPLVYGNPWTRDACNQV
KLLGSWDFDCNTFHTDLSQYITQYVPSLSPVAASTTAAQAPPPPPPVQAQEPAPAPAGEAVQESDPAAVTAPKLK
GSVARVEYRDQNGKVLDENLVASLRAEGKVKFETRYEAGHPLENAHEVPIVDGQLAPPHPDVQGQNPETASAPED
IVPPESPASVADGNERSVEQPSSMEAKPASEGNDATS*
Coding >Pro_DTO070G2_2|g96.t1
ATGGGCCAGAAAGCGCAAGACACGCTGGCCGTGCGGCCACAGAGCCGTGGTAGGCGCTCGCCCAGTCGGTCGCCT
AAGCCCAAGAACCGCAAGCCTTTGGCGGTGCCTCAGACGTATGCCTCGGAAGGAGTGAAGAACAATGACATCTTC
AAACTCCCCGGCTCGGACTATAGACTTATTGTACTGGTAACTCTGATCGCCGCAGCTGTTCGCCTATTCAGAATC
TATCAGCCCACCAGCGTGGTCTTCGATGAAGTCCACTTCGGTGGATTTGCTTCCAAATATATCAAGGGAAAATTC
TTCATGGACGTGCACCCCCCGCTAGCTAAACTGCTGCTTACGCTGGCTGGTTGGTTGGCTGGGTTCGACGGAAAC
TTCGACTTCAAGGATATTGGCAAGGATTATTTGGAGCCCGGTGTTCCTTATGTGGCCATGCGCATGCTTCCAGCT
ATTCTGGGTGTCCTGACTGTCCCATTGATGTTCCTCACCCTCAAAGTTACCGGGTGCCGAACTTCAACTTCAGTC
CTAGGTGCTGGTCTTGTTATCTTTGACAACGCTTTGGTCACTCAGTCCCGTCTGATTCTGCTCGACTCCCCACTG
ATTTTCTTTACCGCTCTGACAGCTTTGGCCTTCAGCTGCTTCACCAACCAACAAGAGCTTGGACCGGCCTATGCC
TTCCGTGGCCCGTGGTGGTTCTGGCTCGTGTGTACCGGTCTTTCTCTTGGCGCAACCCTGAGCGTGAAGTGGGTT
GGCCTCTTCACTATGGCTTGGGTTGGATCTCTCACGGCTCTCCAGTTGTGGGTACTGTTGGGCGATTCTAAAAAT
GTCACACCGCGTCTGTGGTTCAAGCATTTCTTCTCTCGGGTATTCTGTCTCATTGTCATTCCTCTCGGTTTCTAC
ATGGCCATGTTTGCCATCCACTTTACATGCTTGGTTAACCCCGGAGAAGGTGACGGCTTCATGTCATCGGAATTC
CAGGCAACTTTGAACTCAAAGTCTATGCAAGATGTTCCCGCAGATGTCTCATTTGGATCCCGGGTCAGCCTCCGC
CACCTGAACACACAGGGCGGCTACCTGCACTCCCACCCTCATATGTACCCAACAGGTAGCAAGCAGCAGCAGATC
ACGCTCTACCCCCACAAGGATGAGAACAACGAGTTCCTCCTGGAGAACTCGACTCAGCCTCTAGGACCCTATGGA
GAGGTCGAGGGCCCATTCGCCTGGGATAACCTGACTGCTCCTGGTTTCATTGAGGATGGTTCGATTATCAGACTT
TACCATGTGATCACTCACCGAAGAATTCACTCGCATGACGAGCGCCCTCCGGTGACCGAGGCCGACTGGCAGTAT
GAGGTCTCTGCCTATGGATACGAAGGCTTCCCTGGTGATGCCAACGACTTATGGAGGGTTGAGATTGTGAAGTCC
ATGTCCGAGACCCCCGAGTCTAAGAAGCGCTTGCGGACTATTCAGTCCAAGTTCAAGTTGGTGCACGTCATGACT
GGTTGTGTCCTGTTCTCCCACAAGGTCAAGCTTCCGGACTGGGGATACGAGCAGCAGGAAGTGACTTGCGCCAAG
GGTGGTACTCTTCCCAATAGCATTTGGTATATTGAGTCCAACCAGCATCCCGCTATGGCCCCGGACGCCGAGCGA
GTGAACTACCGGAATCCCGGATTCTTGGGCAAGTTCTGGGAATTGCAGAAGGTCATGTGGACCACGAACGCAGGC
TTAGTTGAGTCCCATGCCTGGGATTCTCGTCCGCCCTCCTGGCCTACCCTCCTTCGTGGCATCAACTTCTGGGGC
AAAGACAACCGCCAAATTTACCTCCTCGGAAACCCTCTTATCTGGTGGTCGACCACTCTGGCTATCGGAATCTAT
TTCGTCTTCAAGGCTCTCTCCATTGTTCGGTGGCAACGAAGTTGTGATGACTACAAGCACACTTCGTTCAAGCGC
TTTGACTACGAGGTTGGCACCAGCGTTTTGGGTTGGTTCTTCCACTATTTCCCATTCTACCTCATGGCCCGCCAG
CTCTTCTTGCATCACTACCTCCCTGCCCTTTACTTCGCCATTATGGTCTTTTGCCAAGAATTTGACTTCCTTACA
AACCGCATTAAGAGCCTGGGGCTTGCGTCGAAGCCCTTGATCGGAAAGGCTCTGATGGCAGTCTTCCTGGGACTT
AGCGTTGTTGTATTCACGCTCTACGCCCCACTCGTGTATGGTAACCCCTGGACTAGGGATGCCTGCAATCAGGTG
AAGCTGCTTGGATCCTGGGATTTCGACTGTAACACATTCCACACCGACTTGAGCCAGTACATCACTCAGTACGTG
CCGAGCCTATCCCCCGTGGCTGCCTCTACAACCGCAGCTCAAGCACCACCCCCACCGCCACCAGTCCAGGCTCAA
GAGCCTGCGCCTGCGCCTGCAGGTGAGGCTGTTCAAGAATCAGACCCAGCGGCCGTCACCGCGCCCAAGCTTAAG
GGCTCTGTGGCGCGCGTTGAGTACCGCGACCAAAACGGCAAAGTTCTTGACGAGAACCTTGTAGCCTCGCTCCGA
GCAGAAGGTAAAGTCAAGTTCGAGACTCGCTATGAGGCTGGTCATCCTCTGGAGAATGCCCATGAGGTTCCTATC
GTCGATGGCCAGCTCGCTCCCCCGCACCCGGATGTGCAGGGCCAGAATCCCGAGACTGCCAGCGCGCCCGAAGAC
ATCGTGCCCCCTGAGAGCCCCGCATCTGTGGCCGATGGTAACGAGCGCTCCGTCGAGCAGCCAAGCTCCATGGAA
GCCAAACCTGCCAGCGAGGGCAATGATGCGACTAGCTAG
Transcript >Pro_DTO070G2_2|g96.t1
ATGGGCCAGAAAGCGCAAGACACGCTGGCCGTGCGGCCACAGAGCCGTGGTAGGCGCTCGCCCAGTCGGTCGCCT
AAGCCCAAGAACCGCAAGCCTTTGGCGGTGCCTCAGACGTATGCCTCGGAAGGAGTGAAGAACAATGACATCTTC
AAACTCCCCGGCTCGGACTATAGACTTATTGTACTGGTAACTCTGATCGCCGCAGCTGTTCGCCTATTCAGAATC
TATCAGCCCACCAGCGTGGTCTTCGATGAAGTCCACTTCGGTGGATTTGCTTCCAAATATATCAAGGGAAAATTC
TTCATGGACGTGCACCCCCCGCTAGCTAAACTGCTGCTTACGCTGGCTGGTTGGTTGGCTGGGTTCGACGGAAAC
TTCGACTTCAAGGATATTGGCAAGGATTATTTGGAGCCCGGTGTTCCTTATGTGGCCATGCGCATGCTTCCAGCT
ATTCTGGGTGTCCTGACTGTCCCATTGATGTTCCTCACCCTCAAAGTTACCGGGTGCCGAACTTCAACTTCAGTC
CTAGGTGCTGGTCTTGTTATCTTTGACAACGCTTTGGTCACTCAGTCCCGTCTGATTCTGCTCGACTCCCCACTG
ATTTTCTTTACCGCTCTGACAGCTTTGGCCTTCAGCTGCTTCACCAACCAACAAGAGCTTGGACCGGCCTATGCC
TTCCGTGGCCCGTGGTGGTTCTGGCTCGTGTGTACCGGTCTTTCTCTTGGCGCAACCCTGAGCGTGAAGTGGGTT
GGCCTCTTCACTATGGCTTGGGTTGGATCTCTCACGGCTCTCCAGTTGTGGGTACTGTTGGGCGATTCTAAAAAT
GTCACACCGCGTCTGTGGTTCAAGCATTTCTTCTCTCGGGTATTCTGTCTCATTGTCATTCCTCTCGGTTTCTAC
ATGGCCATGTTTGCCATCCACTTTACATGCTTGGTTAACCCCGGAGAAGGTGACGGCTTCATGTCATCGGAATTC
CAGGCAACTTTGAACTCAAAGTCTATGCAAGATGTTCCCGCAGATGTCTCATTTGGATCCCGGGTCAGCCTCCGC
CACCTGAACACACAGGGCGGCTACCTGCACTCCCACCCTCATATGTACCCAACAGGTAGCAAGCAGCAGCAGATC
ACGCTCTACCCCCACAAGGATGAGAACAACGAGTTCCTCCTGGAGAACTCGACTCAGCCTCTAGGACCCTATGGA
GAGGTCGAGGGCCCATTCGCCTGGGATAACCTGACTGCTCCTGGTTTCATTGAGGATGGTTCGATTATCAGACTT
TACCATGTGATCACTCACCGAAGAATTCACTCGCATGACGAGCGCCCTCCGGTGACCGAGGCCGACTGGCAGTAT
GAGGTCTCTGCCTATGGATACGAAGGCTTCCCTGGTGATGCCAACGACTTATGGAGGGTTGAGATTGTGAAGTCC
ATGTCCGAGACCCCCGAGTCTAAGAAGCGCTTGCGGACTATTCAGTCCAAGTTCAAGTTGGTGCACGTCATGACT
GGTTGTGTCCTGTTCTCCCACAAGGTCAAGCTTCCGGACTGGGGATACGAGCAGCAGGAAGTGACTTGCGCCAAG
GGTGGTACTCTTCCCAATAGCATTTGGTATATTGAGTCCAACCAGCATCCCGCTATGGCCCCGGACGCCGAGCGA
GTGAACTACCGGAATCCCGGATTCTTGGGCAAGTTCTGGGAATTGCAGAAGGTCATGTGGACCACGAACGCAGGC
TTAGTTGAGTCCCATGCCTGGGATTCTCGTCCGCCCTCCTGGCCTACCCTCCTTCGTGGCATCAACTTCTGGGGC
AAAGACAACCGCCAAATTTACCTCCTCGGAAACCCTCTTATCTGGTGGTCGACCACTCTGGCTATCGGAATCTAT
TTCGTCTTCAAGGCTCTCTCCATTGTTCGGTGGCAACGAAGTTGTGATGACTACAAGCACACTTCGTTCAAGCGC
TTTGACTACGAGGTTGGCACCAGCGTTTTGGGTTGGTTCTTCCACTATTTCCCATTCTACCTCATGGCCCGCCAG
CTCTTCTTGCATCACTACCTCCCTGCCCTTTACTTCGCCATTATGGTCTTTTGCCAAGAATTTGACTTCCTTACA
AACCGCATTAAGAGCCTGGGGCTTGCGTCGAAGCCCTTGATCGGAAAGGCTCTGATGGCAGTCTTCCTGGGACTT
AGCGTTGTTGTATTCACGCTCTACGCCCCACTCGTGTATGGTAACCCCTGGACTAGGGATGCCTGCAATCAGGTG
AAGCTGCTTGGATCCTGGGATTTCGACTGTAACACATTCCACACCGACTTGAGCCAGTACATCACTCAGTACGTG
CCGAGCCTATCCCCCGTGGCTGCCTCTACAACCGCAGCTCAAGCACCACCCCCACCGCCACCAGTCCAGGCTCAA
GAGCCTGCGCCTGCGCCTGCAGGTGAGGCTGTTCAAGAATCAGACCCAGCGGCCGTCACCGCGCCCAAGCTTAAG
GGCTCTGTGGCGCGCGTTGAGTACCGCGACCAAAACGGCAAAGTTCTTGACGAGAACCTTGTAGCCTCGCTCCGA
GCAGAAGGTAAAGTCAAGTTCGAGACTCGCTATGAGGCTGGTCATCCTCTGGAGAATGCCCATGAGGTTCCTATC
GTCGATGGCCAGCTCGCTCCCCCGCACCCGGATGTGCAGGGCCAGAATCCCGAGACTGCCAGCGCGCCCGAAGAC
ATCGTGCCCCCTGAGAGCCCCGCATCTGTGGCCGATGGTAACGAGCGCTCCGTCGAGCAGCCAAGCTCCATGGAA
GCCAAACCTGCCAGCGAGGGCAATGATGCGACTAGCTAG
Gene >Pro_DTO070G2_2|g96.t1
ATGGGCCAGAAAGCGCAAGACACGCTGGCCGTGCGGCCACAGAGCCGTGGTAGGCGCTCGCCCAGTCGGTCGCCT
AAGCCCAAGAACCGCAAGCCTTTGGCGGTGCCTCAGACGTATGCCTCGGAAGGAGTGAAGAACAATGACATCTTC
AAACTCCCCGGCTCGGACTATAGACTTATTGTACTGGTAACTCTGATCGCCGCAGCTGTTCGCCTATTCAGAATC
TATCAGCCCACCAGCGTGGTCTTCGATGAAGTCCAGTACGTTCCGCCCAAGCTTGTGTTTTCAATCGGAATAAAA
ACAAACAGAGACTAATGATTACGCGTGAACAGCTTCGGTGGATTTGCTTCCAAATATATCAAGGGAAAATTCTTC
ATGGACGTGCACCCCCCGCTAGCTAAACTGCTGCTTACGCTGGCTGGTTGGTTGGCTGGGTTCGACGGAAACTTC
GACTTCAAGGATATTGGCAAGGATTATTTGGAGCCCGGTGTTCCTTATGTGGCCATGCGCATGCTTCCAGCTATT
CTGGGTGTCCTGACTGTCCCATTGATGTTCCTCACCCTCAAAGTTACCGGGTGCCGAACTTCAACTTCAGTCCTA
GGTGCTGGTCTTGTTATCTTTGACAACGCTTTGGTCACTCAGTCCCGTCTGATTCTGCTCGACTCCCCACTGATT
TTCTTTACCGCTCTGACAGCTTTGGCCTTCAGCTGCTTCACCAACCAACAAGAGCTTGGACCGGCCTATGCCTTC
CGTGGCCCGTGGTGGTTCTGGCTCGTGTGTACCGGTCTTTCTCTTGGCGCAACCCTGAGCGTGAAGTGGGTTGGC
CTCTTCACTATGGCTTGGGTTGGATCTCTCACGGCTCTCCAGTTGTGGGTACTGTTGGGCGATTCTAAAAATGTC
ACACCGGTATGGGTTTCCAAATTCAGATCAAGCCGTGTTCTATGCTAACAGTAGGATTCTTACAGCGTCTGTGGT
TCAAGCATTTCTTCTCTCGGGTATTCTGTCTCATTGTCATTCCTCTCGGTTTCTACATGGCCATGTTTGCCATCC
ACTTTACATGCTTGGTTAACCCCGGAGAAGGTGACGGCTTCATGTCATCGGAATTCCAGGCAACTTTGAACTCAA
AGTCTATGCAAGATGTTCCCGCAGATGTCTCATTTGGATCCCGGGTCAGCCTCCGCCACCTGAACACACAGGGCG
GCTACCTGCACTCCCACCCTCATATGTACCCAACAGGTAGCAAGCAGCAGCAGATCACGCTCTACCCCCACAAGG
ATGAGAACAACGAGTTCCTCCTGGAGAACTCGACTCAGCCTCTAGGACCCTATGGAGAGGTCGAGGGCCCATTCG
CCTGGGATAACCTGACTGCTCCTGGTTTCATTGAGGATGGTTCGATTATCAGACTTTACCATGTGATCACTCACC
GAAGAATTCACTCGCATGACGAGCGCCCTCCGGTGACCGAGGCCGACTGGCAGTATGAGGTCTCTGCCTATGGAT
ACGAAGGCTTCCCTGGTGATGCCAACGACTTATGGAGGGTTGAGATTGTGAAGTCCATGTCCGAGACCCCCGAGT
CTAAGAAGCGCTTGCGGACTATTCAGTCCAAGTTCAAGTTGGTGCACGTCATGACTGGTTGTGTCCTGTTCTCCC
ACAAGGTCAAGCTTCCGGACTGGGGATACGAGCAGCAGGAAGTGACTTGCGCCAAGGGTGGTACTCTTCCCAATA
GCATTTGGTATATTGAGTCCAACCAGCATCCCGCTATGGCCCCGGACGCCGAGCGAGTGAACTACCGGAATCCCG
GATTCTTGGGCAAGTTCTGGGAATTGCAGAAGGTCATGTGGACCACGAACGCAGGCTTAGTTGAGTCCCATGCCT
GGGATTCTCGTCCGCCCTCCTGGCCTACCCTCCTTCGTGGCATCAACTTCTGGGGCAAAGACAACCGCCAAATTT
ACCTCCTCGGAAACCCTCTTATCTGGTGGTCGACCACTCTGGCTATCGGAATCTATTTCGTCTTCAAGGCTCTCT
CCATTGTTCGGTGGCAACGAAGTTGTGATGACTACAAGCACACTTCGTTCAAGCGCTTTGACTACGAGGTTGGCA
CCAGCGTTTTGGGTTGGTTCTTCCACTATTTCCCATTCTACCTCATGGCCCGCCAGCTCTTCTTGCATCACTACC
TCCCTGCCCTTTACTTCGCCATTATGGTCTTTTGCCAAGAATTTGACTTCCTTACAAACCGCATTAAGAGCCTGG
GGCTTGCGTCGAAGCCCTTGATCGGAAAGGCTCTGATGGCAGTCTTCCTGGGACTTAGCGTTGTTGTATTCACGC
TCTACGCCCCACTCGTGTATGGTAACCCCTGGACTAGGGATGCCTGCAATCAGGTGAAGCTGCTTGGATCCTGGG
ATTTCGACTGTAACACATTCCACACCGACGTAAGTGTTCCGGAATGGAAACCTCCTCGACGAGGTTATTGAACGA
ATCGACGAGATCACGACTGACATAGGCCTTTCGAACTCCACTAGTTGAGCCAGTACATCACTCAGTACGTGCCGA
GCCTATCCCCCGTGGCTGCCTCTACAACCGCAGCTCAAGCACCACCCCCACCGCCACCAGTCCAGGCTCAAGAGC
CTGCGCCTGCGCCTGCAGGTGAGGCTGTTCAAGAATCAGACCCAGCGGCCGTCACCGCGCCCAAGCTTAAGGGCT
CTGTGGCGCGCGTTGAGTACCGCGACCAAAACGGCAAAGTTCTTGACGAGAACCTTGTAGCCTCGCTCCGAGCAG
AAGGTAAAGTCAAGTTCGAGACTCGCTATGAGGCTGGTCATCCTCTGGAGAATGCCCATGAGGTTCCTATCGTCG
ATGGCCAGCTCGCTCCCCCGCACCCGGATGTGCAGGGCCAGAATCCCGAGACTGCCAGCGCGCCCGAAGACATCG
TGCCCCCTGAGAGCCCCGCATCTGTGGCCGATGGTAACGAGCGCTCCGTCGAGCAGCCAAGCTCCATGGAAGCCA
AACCTGCCAGCGAGGGCAATGATGCGACTAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail