Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g958.t1
Gene name
Locationscaffold_01:2574499..2576452
Strand+
Gene length (bp)1953
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07676 PD40 WD40-like Beta Propeller Repeat 2.2E-05 76 109
PF07676 PD40 WD40-like Beta Propeller Repeat 3.0E-02 118 153
PF07676 PD40 WD40-like Beta Propeller Repeat 3.1E-07 180 200
PF07676 PD40 WD40-like Beta Propeller Repeat 9.9E-03 241 255
PF07676 PD40 WD40-like Beta Propeller Repeat 2.1E-03 480 502
PF07676 PD40 WD40-like Beta Propeller Repeat 2.5E-01 525 546

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g958.t1
MFFFSLLALLGPSLCQAACPYAHLADASLKPRSDAVLPRTVPGKKGIMLMNRINPSSSKLYIANADGTNERSLLG
NASNYEYHASFHPDGKHVVFTTERNGDGNSDIYMVNVNGSGLTPIATTPSVEDAAVISPNGKYAAYASTAGVYTS
NIWLKNLGIGVTRNLTNQTGVTGKPESPSGFFAPAWSPDGEWIVFSSDRNTAWTGHDNGTGWEHTQELAIYAITP
KGTGFREVYSKANYTYGSPRFSPDGKRVVFYEMTVQTTWDARSSFTVNSTTNQIVSVDFETGTDFVQHTNTSGVK
IFPQYVSNTDIGYLLKGGDDGGIHYTSSAKKILGGMRSPAWSADGKHVVYEKTGWEIRPLQKELWSWDPEWDYHF
MDVFPDLSLDGQLTFTSKQTGSPGNSSIAVMPPGDTKFTLAFDTYETGALDEATVSSGEGGSFQPSWSSDSEWIT
FGLGWWFQSRADEPGWIFRAKSDGSSYEQLTFGNSSNKGFPSFSPDGKKIVYREYLPEFGLRLLDLNSNETTTLT
TERDNLPFFSPSGEWVLFTRNMTDLSKNEFSNYEVCIIRPNGTDLTVLTTSFANDAHAVWTADGRIMWSTGMWGF
QAEAATYDDTFQPYGQIMVMDADGSNKTVLTDSMWEDSMPRYVPNKFLTQ*
Coding >Pro_DTO070G2_2|g958.t1
ATGTTCTTTTTCTCCCTTCTGGCCCTATTGGGCCCTTCACTGTGCCAGGCCGCCTGCCCCTACGCGCATCTAGCA
GATGCAAGCCTCAAGCCTCGCTCTGATGCCGTGCTCCCTCGTACTGTGCCGGGAAAGAAAGGCATCATGTTGATG
AACCGTATCAATCCCTCCTCATCCAAACTGTACATTGCCAATGCAGATGGCACAAATGAACGCTCCTTGCTGGGC
AATGCCTCCAACTACGAATACCATGCCTCCTTCCATCCAGACGGTAAGCACGTCGTCTTCACCACTGAACGTAAC
GGCGATGGCAACTCCGATATCTATATGGTCAACGTGAACGGCAGCGGTCTGACACCAATCGCAACCACACCCTCG
GTCGAAGATGCGGCAGTTATATCTCCCAATGGCAAGTACGCTGCCTACGCCTCCACGGCCGGCGTCTACACCTCC
AACATTTGGCTCAAGAACCTCGGGATCGGCGTTACCCGCAACCTCACCAACCAGACTGGTGTGACGGGCAAGCCT
GAGTCGCCAAGCGGATTCTTTGCGCCTGCCTGGTCGCCTGATGGAGAATGGATCGTTTTTTCCTCTGATCGAAAC
ACCGCGTGGACCGGTCATGACAATGGCACTGGCTGGGAGCATACTCAAGAGCTGGCTATCTATGCCATCACCCCC
AAGGGAACTGGCTTCCGCGAGGTGTACAGCAAGGCGAATTACACTTACGGGTCGCCGAGATTCTCCCCCGATGGC
AAGCGAGTTGTATTCTACGAGATGACGGTGCAAACAACTTGGGATGCGCGTTCGTCGTTCACCGTCAACTCCACA
ACCAACCAAATCGTTTCTGTGGACTTCGAAACAGGAACCGATTTTGTCCAACATACCAATACCTCCGGTGTCAAG
ATTTTCCCGCAGTATGTCTCGAACACTGACATCGGATACTTGCTCAAAGGCGGAGACGACGGCGGTATTCACTAC
ACTTCCAGTGCAAAGAAGATTCTCGGAGGTATGCGCTCACCTGCCTGGTCTGCTGACGGCAAACATGTGGTCTAC
GAGAAGACTGGCTGGGAGATCCGGCCATTGCAAAAGGAGCTGTGGTCCTGGGACCCGGAGTGGGATTACCACTTC
ATGGACGTCTTCCCCGATCTCTCTCTTGATGGGCAATTGACCTTCACCTCCAAGCAAACGGGTAGCCCCGGCAAT
TCTTCTATAGCCGTAATGCCCCCGGGCGACACCAAATTCACCTTGGCGTTTGATACCTACGAAACCGGCGCGCTT
GACGAAGCCACCGTTTCCAGCGGTGAAGGTGGGTCCTTCCAGCCATCCTGGTCGTCTGATAGTGAATGGATCACC
TTCGGTCTAGGATGGTGGTTCCAAAGCCGCGCCGATGAGCCCGGCTGGATCTTCCGGGCCAAGTCCGATGGATCG
AGCTATGAGCAACTCACCTTCGGCAACTCCTCCAATAAGGGATTCCCCAGCTTCTCGCCCGACGGAAAGAAGATC
GTGTACCGCGAATACCTGCCTGAGTTCGGCCTGCGTTTGCTAGACCTAAACTCTAACGAGACCACCACTCTGACG
ACAGAGCGTGATAATCTGCCATTCTTCTCGCCGTCCGGCGAGTGGGTTCTGTTTACGCGCAATATGACCGACCTG
TCGAAGAACGAGTTCTCAAATTATGAAGTGTGCATTATTCGTCCTAATGGGACAGATTTGACTGTGCTCACTACA
TCGTTTGCTAACGATGCCCACGCTGTCTGGACTGCTGATGGCCGCATTATGTGGTCCACTGGAATGTGGGGATTC
CAGGCTGAAGCTGCGACTTACGATGATACCTTCCAGCCTTACGGCCAGATTATGGTTATGGATGCTGATGGCTCG
AACAAAACGGTCCTCACTGATAGCATGTGGGAGGATTCGATGCCGCGTTATGTACCTAATAAGTTTTTGACGCAG
TGA
Transcript >Pro_DTO070G2_2|g958.t1
ATGTTCTTTTTCTCCCTTCTGGCCCTATTGGGCCCTTCACTGTGCCAGGCCGCCTGCCCCTACGCGCATCTAGCA
GATGCAAGCCTCAAGCCTCGCTCTGATGCCGTGCTCCCTCGTACTGTGCCGGGAAAGAAAGGCATCATGTTGATG
AACCGTATCAATCCCTCCTCATCCAAACTGTACATTGCCAATGCAGATGGCACAAATGAACGCTCCTTGCTGGGC
AATGCCTCCAACTACGAATACCATGCCTCCTTCCATCCAGACGGTAAGCACGTCGTCTTCACCACTGAACGTAAC
GGCGATGGCAACTCCGATATCTATATGGTCAACGTGAACGGCAGCGGTCTGACACCAATCGCAACCACACCCTCG
GTCGAAGATGCGGCAGTTATATCTCCCAATGGCAAGTACGCTGCCTACGCCTCCACGGCCGGCGTCTACACCTCC
AACATTTGGCTCAAGAACCTCGGGATCGGCGTTACCCGCAACCTCACCAACCAGACTGGTGTGACGGGCAAGCCT
GAGTCGCCAAGCGGATTCTTTGCGCCTGCCTGGTCGCCTGATGGAGAATGGATCGTTTTTTCCTCTGATCGAAAC
ACCGCGTGGACCGGTCATGACAATGGCACTGGCTGGGAGCATACTCAAGAGCTGGCTATCTATGCCATCACCCCC
AAGGGAACTGGCTTCCGCGAGGTGTACAGCAAGGCGAATTACACTTACGGGTCGCCGAGATTCTCCCCCGATGGC
AAGCGAGTTGTATTCTACGAGATGACGGTGCAAACAACTTGGGATGCGCGTTCGTCGTTCACCGTCAACTCCACA
ACCAACCAAATCGTTTCTGTGGACTTCGAAACAGGAACCGATTTTGTCCAACATACCAATACCTCCGGTGTCAAG
ATTTTCCCGCAGTATGTCTCGAACACTGACATCGGATACTTGCTCAAAGGCGGAGACGACGGCGGTATTCACTAC
ACTTCCAGTGCAAAGAAGATTCTCGGAGGTATGCGCTCACCTGCCTGGTCTGCTGACGGCAAACATGTGGTCTAC
GAGAAGACTGGCTGGGAGATCCGGCCATTGCAAAAGGAGCTGTGGTCCTGGGACCCGGAGTGGGATTACCACTTC
ATGGACGTCTTCCCCGATCTCTCTCTTGATGGGCAATTGACCTTCACCTCCAAGCAAACGGGTAGCCCCGGCAAT
TCTTCTATAGCCGTAATGCCCCCGGGCGACACCAAATTCACCTTGGCGTTTGATACCTACGAAACCGGCGCGCTT
GACGAAGCCACCGTTTCCAGCGGTGAAGGTGGGTCCTTCCAGCCATCCTGGTCGTCTGATAGTGAATGGATCACC
TTCGGTCTAGGATGGTGGTTCCAAAGCCGCGCCGATGAGCCCGGCTGGATCTTCCGGGCCAAGTCCGATGGATCG
AGCTATGAGCAACTCACCTTCGGCAACTCCTCCAATAAGGGATTCCCCAGCTTCTCGCCCGACGGAAAGAAGATC
GTGTACCGCGAATACCTGCCTGAGTTCGGCCTGCGTTTGCTAGACCTAAACTCTAACGAGACCACCACTCTGACG
ACAGAGCGTGATAATCTGCCATTCTTCTCGCCGTCCGGCGAGTGGGTTCTGTTTACGCGCAATATGACCGACCTG
TCGAAGAACGAGTTCTCAAATTATGAAGTGTGCATTATTCGTCCTAATGGGACAGATTTGACTGTGCTCACTACA
TCGTTTGCTAACGATGCCCACGCTGTCTGGACTGCTGATGGCCGCATTATGTGGTCCACTGGAATGTGGGGATTC
CAGGCTGAAGCTGCGACTTACGATGATACCTTCCAGCCTTACGGCCAGATTATGGTTATGGATGCTGATGGCTCG
AACAAAACGGTCCTCACTGATAGCATGTGGGAGGATTCGATGCCGCGTTATGTACCTAATAAGTTTTTGACGCAG
TGA
Gene >Pro_DTO070G2_2|g958.t1
ATGTTCTTTTTCTCCCTTCTGGCCCTATTGGGCCCTTCACTGTGCCAGGCCGCCTGCCCCTACGCGCATCTAGCA
GATGCAAGCCTCAAGCCTCGCTCTGATGCCGTGCTCCCTCGTACTGTGCCGGGAAAGAAAGGCATCATGTTGATG
AACCGTATCAATCCCTCCTCATCCAAACTGTACATTGCCAATGCAGATGGCACAAATGAACGCTCCTTGCTGGGC
AATGCCTCCAACTACGAATACCATGCCTCCTTCCATCCAGACGGTAAGCACGTCGTCTTCACCACTGAACGTAAC
GGCGATGGCAACTCCGATATCTATATGGTCAACGTGAACGGCAGCGGTCTGACACCAATCGCAACCACACCCTCG
GTCGAAGATGCGGCAGTTATATCTCCCAATGGCAAGTACGCTGCCTACGCCTCCACGGCCGGCGTCTACACCTCC
AACATTTGGCTCAAGAACCTCGGGATCGGCGTTACCCGCAACCTCACCAACCAGACTGGTGTGACGGGCAAGCCT
GAGTCGCCAAGCGGATTCTTTGCGCCTGCCTGGTCGCCTGATGGAGAATGGATCGTTTTTTCCTCTGATCGAAAC
ACCGCGTGGACCGGTCATGACAATGGCACTGGCTGGGAGCATACTCAAGAGCTGGCTATCTATGCCATCACCCCC
AAGGGAACTGGCTTCCGCGAGGTGTACAGCAAGGCGAATTACACTTACGGGTCGCCGAGATTCTCCCCCGATGGC
AAGCGAGTTGTATTCTACGAGATGACGGTGCAAACAACTTGGGATGCGCGTTCGTCGTTCACCGTCAACTCCACA
ACCAACCAAATCGTTTCTGTGGACTTCGAAACAGGAACCGATTTTGTCCAACATACCAATACCTCCGGTGTCAAG
ATTTTCCCGCAGTATGTCTCGAACACTGACATCGGATACTTGCTCAAAGGCGGAGACGACGGCGGTATTCACTAC
ACTTCCAGTGCAAAGAAGATTCTCGGAGGTATGCGCTCACCTGCCTGGTCTGCTGACGGCAAACATGTGGTCTAC
GAGAAGACTGGCTGGGAGATCCGGCCATTGCAAAAGGAGCTGTGGTCCTGGGACCCGGAGTGGGATTACCACTTC
ATGGACGTCTTCCCCGATCTCTCTCTTGATGGGCAATTGACCTTCACCTCCAAGCAAACGGGTAGCCCCGGCAAT
TCTTCTATAGCCGTAATGCCCCCGGGCGACACCAAATTCACCTTGGCGTTTGATACCTACGAAACCGGCGCGCTT
GACGAAGCCACCGTTTCCAGCGGTGAAGGTGGGTCCTTCCAGCCATCCTGGTCGTCTGATAGTGAATGGATCACC
TTCGGTCTAGGATGGTGGTTCCAAAGCCGCGCCGATGAGCCCGGCTGGATCTTCCGGGCCAAGTCCGATGGATCG
AGCTATGAGCAACTCACCTTCGGCAACTCCTCCAATAAGGGATTCCCCAGCTTCTCGCCCGACGGAAAGAAGATC
GTGTACCGCGAATACCTGCCTGAGTTCGGCCTGCGTTTGCTAGACCTAAACTCTAACGAGACCACCACTCTGACG
ACAGAGCGTGATAATCTGCCATTCTTCTCGCCGTCCGGCGAGTGGGTTCTGTTTACGCGCAATATGACCGACCTG
TCGAAGAACGAGTTCTCAAATTATGAAGTGTGCATTATTCGTCCTAATGGGACAGATTTGACTGTGCTCACTACA
TCGTTTGCTAACGATGCCCACGCTGTCTGGACTGCTGATGGCCGCATTATGTGGTCCACTGGAATGTGGGGATTC
CAGGCTGAAGCTGCGACTTACGATGATACCTTCCAGCCTTACGGCCAGATTATGGTTATGGATGCTGATGGCTCG
AACAAAACGGTCCTCACTGATAGCATGTGGGAGGATTCGATGCCGCGTTATGTACCTAATAAGTTTTTGACGCAG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail