Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g956.t1
Gene name
Locationscaffold_01:2569907..2571337
Strand+
Gene length (bp)1430
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 4.3E-32 126 253

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g956.t1
MRIQPIWVATLATCVFAKLHVGPVHTVAIEQPQPETESHLDTRDAPNNLDYRCGPKIGKCPVGTCCSGAGFCGTS
KAHCRSPDCKLDYGKCDAHRSPSGPPTKEIPRPHVGQVPYGPREIRSCAIPGTVALTFDDGPTRYTGDLLDLLDK
YDAKATFFITGINNGKGSIDDLTLPWASLIERMHSSGHQIASHTWSHEDLSKITPSQRNEQIEKNEAALRNILGS
FPTYMRPPYSSCSPDTECGNELGELGYHIILYDIDTDDYKNDSPDLIQRSKDIFDHQLLNSDPRTKSWLVIAHDA
HEQTVHNLTEHMLKGIKRQGYRAITVGDCLRDPRPLWYRKDSRMPTQKKKPKNTASADPNKPISWDGSCGSNYTC
LGSTYGFCCGSTSSCGNTTSHCGSGCQKDAGYCSVEAPYNGDAWDPKVQTKGHKSEADSDFRTIGTAAATSLFLA
LIVAMWM*
Coding >Pro_DTO070G2_2|g956.t1
ATGCGTATTCAACCCATCTGGGTCGCCACTTTGGCAACGTGTGTATTTGCTAAATTGCATGTCGGTCCTGTGCAT
ACGGTTGCAATTGAACAACCTCAACCAGAAACCGAGTCTCATTTGGACACTCGTGATGCCCCCAACAATTTGGAC
TATCGCTGTGGCCCCAAGATCGGCAAATGTCCGGTCGGTACATGCTGCTCGGGTGCAGGTTTCTGCGGCACGTCG
AAGGCGCACTGTCGCTCTCCAGACTGCAAGCTTGACTACGGTAAATGTGACGCTCACCGATCGCCTTCTGGACCC
CCAACCAAGGAAATCCCCCGTCCTCACGTCGGCCAAGTTCCGTACGGCCCTCGCGAGATTCGTTCATGCGCTATC
CCCGGAACTGTTGCATTGACCTTCGACGATGGCCCGACACGTTACACTGGCGATCTGCTCGATTTGCTTGACAAA
TACGATGCGAAGGCGACATTCTTCATCACTGGGATCAACAACGGAAAGGGCTCTATCGATGACCTCACCTTGCCA
TGGGCTTCATTGATTGAACGCATGCACTCGAGTGGCCACCAGATTGCCAGTCATACATGGTCGCATGAGGACCTC
AGTAAGATCACTCCTTCGCAACGCAATGAGCAAATTGAGAAGAACGAAGCTGCGCTGCGCAACATTCTCGGATCT
TTCCCCACTTACATGCGGCCGCCTTATTCCAGCTGCAGCCCTGACACAGAGTGCGGAAATGAGCTGGGCGAGCTT
GGATACCACATCATTTTGTATGACATTGACACGGATGACTATAAAAATGACAGTCCAGATCTGATTCAACGGTCT
AAGGATATCTTTGATCACCAGCTTTTGAACAGCGACCCACGCACCAAATCATGGCTTGTCATTGCCCATGACGCC
CATGAACAGACCGTCCACAACCTCACAGAGCACATGCTCAAGGGCATCAAGCGGCAAGGCTATCGTGCCATTACC
GTCGGCGACTGTCTCCGTGATCCCAGGCCACTCTGGTACCGCAAGGATAGCCGGATGCCCACTCAGAAGAAGAAG
CCCAAGAATACTGCTTCGGCAGATCCCAACAAGCCGATCTCTTGGGACGGGTCCTGTGGTTCCAACTACACTTGC
CTTGGATCTACCTATGGCTTTTGCTGTGGTAGTACTAGCTCTTGTGGCAACACCACCAGTCATTGTGGAAGCGGC
TGTCAAAAGGATGCCGGATATTGTTCCGTTGAGGCTCCTTACAATGGCGATGCCTGGGACCCGAAAGTCCAAACC
AAGGGTCACAAGTCGGAAGCTGATTCTGATTTCCGAACCATTGGCACCGCGGCTGCAACATCGTTGTTCCTTGCT
TTGATCGTTGCGATGTGGATGTGA
Transcript >Pro_DTO070G2_2|g956.t1
ATGCGTATTCAACCCATCTGGGTCGCCACTTTGGCAACGTGTGTATTTGCTAAATTGCATGTCGGTCCTGTGCAT
ACGGTTGCAATTGAACAACCTCAACCAGAAACCGAGTCTCATTTGGACACTCGTGATGCCCCCAACAATTTGGAC
TATCGCTGTGGCCCCAAGATCGGCAAATGTCCGGTCGGTACATGCTGCTCGGGTGCAGGTTTCTGCGGCACGTCG
AAGGCGCACTGTCGCTCTCCAGACTGCAAGCTTGACTACGGTAAATGTGACGCTCACCGATCGCCTTCTGGACCC
CCAACCAAGGAAATCCCCCGTCCTCACGTCGGCCAAGTTCCGTACGGCCCTCGCGAGATTCGTTCATGCGCTATC
CCCGGAACTGTTGCATTGACCTTCGACGATGGCCCGACACGTTACACTGGCGATCTGCTCGATTTGCTTGACAAA
TACGATGCGAAGGCGACATTCTTCATCACTGGGATCAACAACGGAAAGGGCTCTATCGATGACCTCACCTTGCCA
TGGGCTTCATTGATTGAACGCATGCACTCGAGTGGCCACCAGATTGCCAGTCATACATGGTCGCATGAGGACCTC
AGTAAGATCACTCCTTCGCAACGCAATGAGCAAATTGAGAAGAACGAAGCTGCGCTGCGCAACATTCTCGGATCT
TTCCCCACTTACATGCGGCCGCCTTATTCCAGCTGCAGCCCTGACACAGAGTGCGGAAATGAGCTGGGCGAGCTT
GGATACCACATCATTTTGTATGACATTGACACGGATGACTATAAAAATGACAGTCCAGATCTGATTCAACGGTCT
AAGGATATCTTTGATCACCAGCTTTTGAACAGCGACCCACGCACCAAATCATGGCTTGTCATTGCCCATGACGCC
CATGAACAGACCGTCCACAACCTCACAGAGCACATGCTCAAGGGCATCAAGCGGCAAGGCTATCGTGCCATTACC
GTCGGCGACTGTCTCCGTGATCCCAGGCCACTCTGGTACCGCAAGGATAGCCGGATGCCCACTCAGAAGAAGAAG
CCCAAGAATACTGCTTCGGCAGATCCCAACAAGCCGATCTCTTGGGACGGGTCCTGTGGTTCCAACTACACTTGC
CTTGGATCTACCTATGGCTTTTGCTGTGGTAGTACTAGCTCTTGTGGCAACACCACCAGTCATTGTGGAAGCGGC
TGTCAAAAGGATGCCGGATATTGTTCCGTTGAGGCTCCTTACAATGGCGATGCCTGGGACCCGAAAGTCCAAACC
AAGGGTCACAAGTCGGAAGCTGATTCTGATTTCCGAACCATTGGCACCGCGGCTGCAACATCGTTGTTCCTTGCT
TTGATCGTTGCGATGTGGATGTGA
Gene >Pro_DTO070G2_2|g956.t1
ATGCGTATTCAACCCATCTGGGTCGCCACTTTGGCAACGTGTGTATTTGCTAAATTGCATGTCGGTCCTGTGCAT
ACGGTTGCAATTGAACAACCTCAACCAGAAACCGAGTCTCATTTGGACACTCGTGATGCCCCCAACAATTTGGAC
TATCGCTGTGGCCCCAAGATCGGCAAATGTCCGGTCGGTACATGCTGCTCGGGTGCAGGTATGTTCTCAAAATCC
TGTTAGCTTGAGCACCTTACTGATGTCATTCTACGATAGGTTTCTGCGGCACGTCGAAGGCGCACTGTCGCTCTC
CAGACTGCAAGCTTGACTACGGTAAATGTGACGCTCACCGATCGCCTTCTGGACCCCCAACCAAGGAAATCCCCC
GTCCTCACGTCGGCCAAGTTCCGTACGGCCCTCGCGAGATTCGTTCATGCGCTATCCCCGGAACTGTTGCATTGA
CCTTCGACGATGGCCCGACACGTTACACTGGCGATCTGCTCGATTTGCTTGACAAATACGATGCGAAGGCGACAT
TCTTCATCACTGGGATCAACAACGGAAAGGGCTCTATCGATGACCTCACCTTGCCATGGGCTTCATTGATTGAAC
GCATGCACTCGAGTGGCCACCAGATTGCCAGTCATACATGGTCGCATGAGGACCTCAGTAAGATCACTCCTTCGC
AACGCAATGAGCAAATTGAGAAGAACGAAGCTGCGCTGCGCAACATTCTCGGATCTTTCCCCACTTACATGCGGC
CGCCTTATTCCAGCTGCAGCCCTGACACAGAGTGCGGAAATGAGCTGGGCGAGCTTGGATACCACATCATTTTGT
ATGACATTGACACGGATGACTATAAAAATGACAGTCCAGATCTGATTCAACGGTCTAAGGATATCTTTGATCACC
AGCTTTTGAACAGCGACCCACGCACCAAATCATGGCTTGTCATTGCCCATGACGCCCATGAACAGACCGTCCACA
ACCTCACAGAGCACATGCTCAAGGGCATCAAGCGGCAAGGCTATCGTGCCATTACCGTCGGCGACTGTCTCCGTG
ATCCCAGGCCACTCTGGTACCGCAAGGATAGCCGGATGCCCACTCAGAAGAAGAAGCCCAAGAATACTGCTTCGG
CAGATCCCAACAAGCCGATCTCTTGGGACGGGTCCTGTGGTTCCAACTACACTTGCCTTGGATCTACCTATGGCT
TTTGCTGTGGTAGTACTAGCTCTTGTGGCAACACCACCAGTCATTGTGGAAGCGGCTGTCAAAAGGATGCCGGAT
ATTGTTCCGTTGAGGCTCCTTACAATGGCGATGCCTGGGACCCGAAAGTCCAAACCAAGGGTCACAAGTCGGAAG
CTGATTCTGATTTCCGAACCATTGGCACCGCGGCTGCAACATCGTTGTTCCTTGCTTTGATCGTTGCGATGTGGA
TGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail