Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g9442.t1
Gene name
Locationscaffold_28:48583..49668
Strand-
Gene length (bp)1085
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02265 S1-P1_nuclease S1/P1 Nuclease 6.8E-69 21 284

GO

GO Term Description Terminal node
GO:0004519 endonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:0006308 DNA catabolic process Yes
GO:0004518 nuclease activity No
GO:0008150 biological_process No
GO:0009057 macromolecule catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0008152 metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006259 DNA metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0044238 primary metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:0005488 binding No
GO:1901575 organic substance catabolic process No
GO:0009056 catabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g9442.t1
MVSLFRIAFVTFGVIHGANAWGVLGHATVAYVAQHYISSEAASWAQEILNDTSSSYLANIASWADQYRLKDDGKW
SAPLHYIDAMDDPPTSCNVDYERDCGAEGCSISAIANYTQRAGDSKLTTANTAEALRFLVHFLGDLTQPLHDENY
EVGGNGISVTFNNYSDNLHSDWDTYMPVQLIGGSSLADAQGWADSLVDEITSGTYKKQAASWIKGDTISDTITTA
TRWASDANSFVCTVVMPDGAAALQTGDLYPTYYNSAIGTIELQIAKGGYRLANWLNMIYKQNVTAKNTPGKFGKG
HRQPEFVREPHHEPNKMSRANLARAAMGGSCCKSEGREHSH*
Coding >Pro_DTO070G2_2|g9442.t1
ATGGTGTCTCTATTCAGGATTGCTTTCGTCACCTTCGGGGTGATTCATGGCGCAAATGCGTGGGGCGTACTAGGC
CACGCGACTGTTGCCTATGTGGCACAACATTACATTTCTTCTGAAGCCGCATCATGGGCACAAGAAATTCTCAAT
GATACTTCCAGCTCATACCTAGCAAACATTGCTTCCTGGGCAGATCAATACCGCCTCAAAGATGACGGCAAATGG
TCAGCCCCTTTGCACTACATTGATGCCATGGATGACCCGCCAACAAGCTGCAACGTGGACTACGAGCGCGACTGT
GGAGCTGAAGGCTGCTCGATCTCTGCCATTGCCAACTATACCCAGCGTGCAGGGGATAGCAAACTCACTACTGCC
AATACCGCCGAAGCTCTCAGATTCCTCGTGCACTTCCTTGGCGATCTCACGCAGCCATTGCACGACGAGAACTAC
GAGGTTGGCGGAAATGGCATCAGTGTCACTTTCAACAACTACTCTGACAACCTTCATTCGGACTGGGATACATAC
ATGCCTGTACAGCTGATTGGCGGTAGTTCGCTCGCCGATGCGCAGGGATGGGCCGACAGCCTGGTCGATGAAATC
ACTTCCGGCACCTACAAAAAGCAAGCAGCGAGCTGGATCAAAGGCGATACCATCAGTGATACTATCACCACTGCC
ACTCGATGGGCATCGGATGCCAATTCTTTTGTCTGTACTGTTGTCATGCCGGATGGAGCCGCTGCCTTGCAGACT
GGCGATCTATACCCGACATACTACAACTCCGCCATCGGCACGATCGAGCTCCAGATTGCTAAAGGCGGCTACCGA
CTAGCCAATTGGCTCAACATGATTTACAAGCAGAATGTTACTGCTAAGAATACGCCAGGGAAATTCGGCAAAGGG
CACCGACAGCCTGAATTTGTCCGCGAGCCTCACCATGAGCCTAATAAGATGAGCCGCGCAAATCTAGCTAGAGCT
GCTATGGGAGGATCTTGCTGCAAATCAGAAGGACGTGAGCATAGCCATTGA
Transcript >Pro_DTO070G2_2|g9442.t1
ATGGTGTCTCTATTCAGGATTGCTTTCGTCACCTTCGGGGTGATTCATGGCGCAAATGCGTGGGGCGTACTAGGC
CACGCGACTGTTGCCTATGTGGCACAACATTACATTTCTTCTGAAGCCGCATCATGGGCACAAGAAATTCTCAAT
GATACTTCCAGCTCATACCTAGCAAACATTGCTTCCTGGGCAGATCAATACCGCCTCAAAGATGACGGCAAATGG
TCAGCCCCTTTGCACTACATTGATGCCATGGATGACCCGCCAACAAGCTGCAACGTGGACTACGAGCGCGACTGT
GGAGCTGAAGGCTGCTCGATCTCTGCCATTGCCAACTATACCCAGCGTGCAGGGGATAGCAAACTCACTACTGCC
AATACCGCCGAAGCTCTCAGATTCCTCGTGCACTTCCTTGGCGATCTCACGCAGCCATTGCACGACGAGAACTAC
GAGGTTGGCGGAAATGGCATCAGTGTCACTTTCAACAACTACTCTGACAACCTTCATTCGGACTGGGATACATAC
ATGCCTGTACAGCTGATTGGCGGTAGTTCGCTCGCCGATGCGCAGGGATGGGCCGACAGCCTGGTCGATGAAATC
ACTTCCGGCACCTACAAAAAGCAAGCAGCGAGCTGGATCAAAGGCGATACCATCAGTGATACTATCACCACTGCC
ACTCGATGGGCATCGGATGCCAATTCTTTTGTCTGTACTGTTGTCATGCCGGATGGAGCCGCTGCCTTGCAGACT
GGCGATCTATACCCGACATACTACAACTCCGCCATCGGCACGATCGAGCTCCAGATTGCTAAAGGCGGCTACCGA
CTAGCCAATTGGCTCAACATGATTTACAAGCAGAATGTTACTGCTAAGAATACGCCAGGGAAATTCGGCAAAGGG
CACCGACAGCCTGAATTTGTCCGCGAGCCTCACCATGAGCCTAATAAGATGAGCCGCGCAAATCTAGCTAGAGCT
GCTATGGGAGGATCTTGCTGCAAATCAGAAGGACGTGAGCATAGCCATTGA
Gene >Pro_DTO070G2_2|g9442.t1
ATGGTGTCTCTATTCAGGATTGCTTTCGTCACCTTCGGGGTGATTCATGGCGCAAATGCGTGGGGCGTACTAGGC
CACGCGACTGTTGCCTATGTGGCACAACATTACATTTCTTCTGAAGCCGCATCATGGTAAGTCCTCCGAAAGAGC
TTCCAGATAAAGACAGTATCCAATGCTAATCTATTTGAAGGGCACAAGAAATTCTCAATGATACTTCCAGCTCAT
ACCTAGCAAACATTGCTTCCTGGGCAGATCAATACCGCCTCAAAGATGACGGCAAATGGTCAGCCCCTTTGCACT
ACATTGATGCCATGGATGACCCGCCAACAAGCTGCAACGTGGACTACGAGCGCGACTGTGGAGCTGAAGGCTGCT
CGATCTCTGCCATTGCCAACTATACCCAGCGTGCAGGGGATAGCAAACTCACTACTGCCAATACCGCCGAAGCTC
TCAGATTCCTCGTGCACTTCCTTGGCGATCTCACGCAGCCATTGCACGACGAGAACTACGAGGTTGGCGGAAATG
GCATCAGTGTCACTTTCAACAACTACTCTGACAACCTTCATTCGGACTGGGATACATACATGCCTGTACAGCTGA
TTGGCGGTAGTTCGCTCGCCGATGCGCAGGGATGGGCCGACAGCCTGGTCGATGAAATCACTTCCGGCACCTACA
AAAAGCAAGCAGCGAGCTGGATCAAAGGCGATACCATCAGTGATACTATCACCACTGCCACTCGATGGGCATCGG
ATGCCAATTCTTTTGTCTGTACTGTTGTCATGCCGGATGGAGCCGCTGCCTTGCAGACTGGCGATCTATACCCGA
CATACTACAACTCCGCCATCGGCACGATCGAGCTCCAGATTGCTAAAGGCGGCTACCGACTAGCCAATTGGCTCA
ACATGATTTACAAGCAGAATGTTACTGCTAAGAATACGCCAGGGAAATTCGGCAAAGGGCACCGACAGCCTGAAT
TTGTCCGCGAGCCTCACCATGAGCCTAATAAGATGAGCCGCGCAAATCTAGCTAGAGCTGCTATGGGAGGATCTT
GCTGCAAATCAGAAGGACGTGAGCATAGCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail