Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g9349.t1
Gene name
Locationscaffold_27:28197..29115
Strand+
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06682 SARAF SOCE-associated regulatory factor of calcium homoeostasis 2.2E-91 12 305

GO

GO Term Description Terminal node
GO:2001256 regulation of store-operated calcium entry Yes
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0008150 biological_process No
GO:0031300 intrinsic component of organelle membrane No
GO:0032879 regulation of localization No
GO:0031224 intrinsic component of membrane No
GO:0031301 integral component of organelle membrane No
GO:0051049 regulation of transport No
GO:0016021 integral component of membrane No
GO:0005575 cellular_component No
GO:0051924 regulation of calcium ion transport No
GO:0050789 regulation of biological process No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0010959 regulation of metal ion transport No
GO:0043269 regulation of ion transport No
GO:0110165 cellular anatomical entity No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 172 194 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g9349.t1
MHILPKLAITALLLISPATCLSSSKPPGKDAILLSNVQTLTLRAHRMTTARRVSPIPQLSCAGPSKQTCNLYQPE
TMRCTNQGYDYDVEDVQWTCTADMPAEFKLGATDVICEGYRNADDKWVLKGSCGVEYRLLLTEAGEKRFGKRNMD
SEWGGSQSGTGVQTIMEMLGNLIFFGFIAAVFILIFLPILAQCFGWGNRRGGRAGQPPGWGGFWGGGGGGGPGGN
DPPPPYSSFDPYKSSARQGWTPGFWTGALGGGAAGYQMGRRAYSGSRGRSDGYDPGEGSSRSPQFSSTTASTGFG
STRRR*
Coding >Pro_DTO070G2_2|g9349.t1
ATGCACATTCTCCCCAAGCTGGCAATCACAGCCTTACTCCTCATCTCACCAGCAACATGCCTCTCAAGCTCCAAA
CCACCAGGCAAAGACGCCATCCTTCTATCAAACGTGCAAACCCTCACACTCCGCGCCCACCGCATGACCACCGCA
CGGCGCGTCTCACCAATCCCCCAACTCAGCTGCGCAGGCCCCTCAAAACAAACGTGTAACCTCTACCAACCAGAA
ACAATGCGCTGCACAAACCAAGGCTACGACTACGACGTCGAAGACGTGCAGTGGACATGCACCGCAGACATGCCG
GCAGAGTTCAAGCTCGGCGCAACAGATGTCATCTGCGAGGGATACCGCAATGCCGATGATAAGTGGGTGTTGAAG
GGGAGCTGTGGGGTTGAGTACCGGCTGCTCTTGACCGAGGCTGGCGAGAAGAGGTTTGGGAAGAGAAACATGGAT
TCGGAGTGGGGCGGGAGCCAGTCCGGGACTGGGGTTCAGACGATCATGGAGATGCTGGGGAACCTGATTTTCTTT
GGGTTCATCGCTGCTGTTTTCATTCTGATCTTCTTGCCTATCTTGGCGCAGTGTTTCGGGTGGGGGAATCGGCGA
GGCGGGCGCGCGGGGCAGCCACCGGGGTGGGGCGGGTTCTGGGGAGGTGGTGGTGGTGGTGGACCTGGCGGAAAT
GATCCTCCGCCTCCGTACAGCAGTTTCGATCCTTATAAATCTTCTGCTCGTCAGGGCTGGACGCCGGGTTTCTGG
ACTGGTGCGCTAGGCGGTGGTGCGGCTGGTTATCAGATGGGCAGACGGGCTTACAGTGGATCGCGCGGCAGGTCT
GATGGATATGACCCCGGTGAAGGCAGCTCGCGCTCGCCGCAGTTCTCATCTACCACTGCTAGTACTGGGTTCGGG
TCGACGAGGCGTAGGTGA
Transcript >Pro_DTO070G2_2|g9349.t1
ATGCACATTCTCCCCAAGCTGGCAATCACAGCCTTACTCCTCATCTCACCAGCAACATGCCTCTCAAGCTCCAAA
CCACCAGGCAAAGACGCCATCCTTCTATCAAACGTGCAAACCCTCACACTCCGCGCCCACCGCATGACCACCGCA
CGGCGCGTCTCACCAATCCCCCAACTCAGCTGCGCAGGCCCCTCAAAACAAACGTGTAACCTCTACCAACCAGAA
ACAATGCGCTGCACAAACCAAGGCTACGACTACGACGTCGAAGACGTGCAGTGGACATGCACCGCAGACATGCCG
GCAGAGTTCAAGCTCGGCGCAACAGATGTCATCTGCGAGGGATACCGCAATGCCGATGATAAGTGGGTGTTGAAG
GGGAGCTGTGGGGTTGAGTACCGGCTGCTCTTGACCGAGGCTGGCGAGAAGAGGTTTGGGAAGAGAAACATGGAT
TCGGAGTGGGGCGGGAGCCAGTCCGGGACTGGGGTTCAGACGATCATGGAGATGCTGGGGAACCTGATTTTCTTT
GGGTTCATCGCTGCTGTTTTCATTCTGATCTTCTTGCCTATCTTGGCGCAGTGTTTCGGGTGGGGGAATCGGCGA
GGCGGGCGCGCGGGGCAGCCACCGGGGTGGGGCGGGTTCTGGGGAGGTGGTGGTGGTGGTGGACCTGGCGGAAAT
GATCCTCCGCCTCCGTACAGCAGTTTCGATCCTTATAAATCTTCTGCTCGTCAGGGCTGGACGCCGGGTTTCTGG
ACTGGTGCGCTAGGCGGTGGTGCGGCTGGTTATCAGATGGGCAGACGGGCTTACAGTGGATCGCGCGGCAGGTCT
GATGGATATGACCCCGGTGAAGGCAGCTCGCGCTCGCCGCAGTTCTCATCTACCACTGCTAGTACTGGGTTCGGG
TCGACGAGGCGTAGGTGA
Gene >Pro_DTO070G2_2|g9349.t1
ATGCACATTCTCCCCAAGCTGGCAATCACAGCCTTACTCCTCATCTCACCAGCAACATGCCTCTCAAGCTCCAAA
CCACCAGGCAAAGACGCCATCCTTCTATCAAACGTGCAAACCCTCACACTCCGCGCCCACCGCATGACCACCGCA
CGGCGCGTCTCACCAATCCCCCAACTCAGCTGCGCAGGCCCCTCAAAACAAACGTGTAACCTCTACCAACCAGAA
ACAATGCGCTGCACAAACCAAGGCTACGACTACGACGTCGAAGACGTGCAGTGGACATGCACCGCAGACATGCCG
GCAGAGTTCAAGCTCGGCGCAACAGATGTCATCTGCGAGGGATACCGCAATGCCGATGATAAGTGGGTGTTGAAG
GGGAGCTGTGGGGTTGAGTACCGGCTGCTCTTGACCGAGGCTGGCGAGAAGAGGTTTGGGAAGAGAAACATGGAT
TCGGAGTGGGGCGGGAGCCAGTCCGGGACTGGGGTTCAGACGATCATGGAGATGCTGGGGAACCTGATTTTCTTT
GGGTTCATCGCTGCTGTTTTCATTCTGATCTTCTTGCCTATCTTGGCGCAGTGTTTCGGGTGGGGGAATCGGCGA
GGCGGGCGCGCGGGGCAGCCACCGGGGTGGGGCGGGTTCTGGGGAGGTGGTGGTGGTGGTGGACCTGGCGGAAAT
GATCCTCCGCCTCCGTACAGCAGTTTCGATCCTTATAAATCTTCTGCTCGTCAGGGCTGGACGCCGGGTTTCTGG
ACTGGTGCGCTAGGCGGTGGTGCGGCTGGTTATCAGATGGGCAGACGGGCTTACAGTGGATCGCGCGGCAGGTCT
GATGGATATGACCCCGGTGAAGGCAGCTCGCGCTCGCCGCAGTTCTCATCTACCACTGCTAGTACTGGGTTCGGG
TCGACGAGGCGTAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail