Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g9311.t1
Gene name
Locationscaffold_26:179678..181107
Strand+
Gene length (bp)1429
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 3.2E-07 154 206
PF14378 PAP2_3 PAP2 superfamily 1.4E-14 234 325
PF14378 PAP2_3 PAP2 superfamily 8.9E-07 352 395

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 115 137 22
3 184 206 22
4 242 264 22
5 309 331 22
6 352 374 22
7 384 406 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g9311.t1
MGAGMVIEPLVVIVLLFGGTWINRSVGSSSTKSYNRRNSNDLGRAASFDSLESGYSSQSTKDGLLSPRSHSPQAP
EDGWHKRQVGLLGLNFEVSSPNTIVFQDSLLSRLLRKFPFLVECWYWALVYWTYQLGRAFTAVTLKDDTVDVARR
HALQLIVIEENLGIFWETLIQRRFLRHPLVMPWINWMYSFIHIPGTIAFLVWLYYYTTVRNRIDEAQPGKPKGAM
SGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDTAVDGDEGDLARSYGFVDTVHGIKGSGSVWTENR
FCNQYAAMPSLHFGYSLLIGLTLITIPLPQHHRHTILRTRLTRALRLELPSWRRLVCVILGFLYPFTILVAIVAT
ANHFILDAVAGALVCALGWYFNGVLLNLLPLEDYFLCLVRIHKPEPSLLDVHEEECPTTESV*
Coding >Pro_DTO070G2_2|g9311.t1
ATGGGAGCTGGAATGGTCATCGAGCCTTTGGTGGTTATTGTTCTCTTATTTGGAGGCACCTGGATTAACCGCTCT
GTCGGATCATCCTCGACTAAAAGCTACAACCGACGGAACTCGAACGACCTTGGACGAGCCGCTTCATTTGATTCT
TTGGAGTCGGGTTACTCAAGCCAATCGACAAAGGATGGTCTGCTGAGCCCTCGCTCCCACTCACCACAAGCCCCG
GAAGACGGATGGCACAAGCGACAAGTTGGACTTTTAGGGTTGAATTTCGAGGTATCCTCGCCGAATACGATTGTA
TTCCAAGACAGTTTGCTCAGTCGATTGCTTCGGAAGTTTCCTTTCTTGGTGGAATGTTGGTATTGGGCTTTGGTT
TACTGGACGTACCAGCTCGGTCGTGCCTTTACCGCCGTGACTCTCAAGGATGACACCGTTGATGTCGCGAGGAGG
CATGCATTGCAACTAATCGTGATCGAGGAGAATCTGGGAATATTCTGGGAGACCTTGATACAGAGACGCTTCCTT
CGCCATCCTCTTGTCATGCCTTGGATCAATTGGATGTACTCGTTCATACACATTCCTGGGACAATCGCGTTTCTC
GTTTGGCTCTATTACTATACTACCGTGCGGAATCGGATCGACGAGGCTCAGCCCGGAAAGCCCAAGGGAGCTATG
AGCGGGTCGCCTGCAGGTCCTCTTCTATACCAGGCGCGTCGGCGGACTTTGGCCGTGTGCAATCTCCTCGCATTC
GTGGTGTTCACTCTTTGGCCTTGCATGCCACCTCGGTTACTGAGTGATACAGCCGTGGATGGTGACGAGGGAGAT
CTAGCCCGCAGTTATGGGTTCGTGGACACGGTGCATGGTATCAAGGGATCGGGCAGTGTGTGGACCGAAAACCGC
TTCTGTAACCAATATGCGGCGATGCCTTCCTTGCATTTCGGCTACTCTTTATTGATCGGCCTCACACTGATCACA
ATCCCTTTGCCGCAGCACCACCGGCACACAATCCTGCGTACTCGGCTGACCCGTGCCTTAAGACTGGAGCTCCCG
TCGTGGCGCCGCCTCGTTTGCGTCATACTCGGCTTCCTATATCCGTTTACCATCCTTGTAGCTATTGTTGCCACT
GCCAACCATTTTATTCTGGATGCTGTCGCAGGAGCGCTTGTATGTGCCTTGGGGTGGTATTTTAATGGGGTGCTG
CTCAACCTGTTGCCACTGGAAGACTACTTCCTTTGCCTTGTCCGGATCCATAAGCCTGAGCCGTCACTTCTCGAT
GTCCACGAGGAGGAGTGTCCCACGACCGAAAGTGTTTGA
Transcript >Pro_DTO070G2_2|g9311.t1
ATGGGAGCTGGAATGGTCATCGAGCCTTTGGTGGTTATTGTTCTCTTATTTGGAGGCACCTGGATTAACCGCTCT
GTCGGATCATCCTCGACTAAAAGCTACAACCGACGGAACTCGAACGACCTTGGACGAGCCGCTTCATTTGATTCT
TTGGAGTCGGGTTACTCAAGCCAATCGACAAAGGATGGTCTGCTGAGCCCTCGCTCCCACTCACCACAAGCCCCG
GAAGACGGATGGCACAAGCGACAAGTTGGACTTTTAGGGTTGAATTTCGAGGTATCCTCGCCGAATACGATTGTA
TTCCAAGACAGTTTGCTCAGTCGATTGCTTCGGAAGTTTCCTTTCTTGGTGGAATGTTGGTATTGGGCTTTGGTT
TACTGGACGTACCAGCTCGGTCGTGCCTTTACCGCCGTGACTCTCAAGGATGACACCGTTGATGTCGCGAGGAGG
CATGCATTGCAACTAATCGTGATCGAGGAGAATCTGGGAATATTCTGGGAGACCTTGATACAGAGACGCTTCCTT
CGCCATCCTCTTGTCATGCCTTGGATCAATTGGATGTACTCGTTCATACACATTCCTGGGACAATCGCGTTTCTC
GTTTGGCTCTATTACTATACTACCGTGCGGAATCGGATCGACGAGGCTCAGCCCGGAAAGCCCAAGGGAGCTATG
AGCGGGTCGCCTGCAGGTCCTCTTCTATACCAGGCGCGTCGGCGGACTTTGGCCGTGTGCAATCTCCTCGCATTC
GTGGTGTTCACTCTTTGGCCTTGCATGCCACCTCGGTTACTGAGTGATACAGCCGTGGATGGTGACGAGGGAGAT
CTAGCCCGCAGTTATGGGTTCGTGGACACGGTGCATGGTATCAAGGGATCGGGCAGTGTGTGGACCGAAAACCGC
TTCTGTAACCAATATGCGGCGATGCCTTCCTTGCATTTCGGCTACTCTTTATTGATCGGCCTCACACTGATCACA
ATCCCTTTGCCGCAGCACCACCGGCACACAATCCTGCGTACTCGGCTGACCCGTGCCTTAAGACTGGAGCTCCCG
TCGTGGCGCCGCCTCGTTTGCGTCATACTCGGCTTCCTATATCCGTTTACCATCCTTGTAGCTATTGTTGCCACT
GCCAACCATTTTATTCTGGATGCTGTCGCAGGAGCGCTTGTATGTGCCTTGGGGTGGTATTTTAATGGGGTGCTG
CTCAACCTGTTGCCACTGGAAGACTACTTCCTTTGCCTTGTCCGGATCCATAAGCCTGAGCCGTCACTTCTCGAT
GTCCACGAGGAGGAGTGTCCCACGACCGAAAGTGTTTGA
Gene >Pro_DTO070G2_2|g9311.t1
ATGGGAGCTGGAATGGTCATCGAGCCTTTGGTGGTTATTGTTCTCTTATTTGGAGGCACCTGGATTAACCGCTCT
GTCGGATCATCCTCGACTAAAAGCTACAACCGACGGAACTCGAACGACCTTGGACGAGCCGCTTCATTTGATTCT
TTGGAGTCGGGTTACTCAAGCCAATCGACAAAGGATGGTCTGCTGAGCCCTCGCTCCCACTCACCACAAGCCCCG
GAAGACGGATGGCACAAGCGACAAGTTGGACTTTTAGGGTTGAATTTCGAGGTATCCTCGCCGAATACGATTGTA
TTCCAAGACAGTTTGCTCAGTCGATTGCTTCGGAAGTTTCCTTTCTTGGTGGAATGTTGGTATTGGGCTTTGGTT
TACTGGGTAGGTTGATTTGCTCCTTAACTTACCATCGGTCTTGGCTAAACCAAACTCACAATTTGTATAGACGTA
CCAGCTCGGTCGTGCCTTTACCGCCGTGACTCTCAAGGATGACACCGTTGATGTCGCGAGGAGGCATGCATTGCA
ACTAATCGTGATCGAGGAGAATCTGGGAATATTCTGGGAGACCTTGATACAGAGACGCTTCCTTCGCCATCCTCT
TGTCATGCCTTGGATCAATTGGATGTACTCGTTCATACACATTCCTGGGACAATCGCGTTTCTCGTTTGGCTCTA
TTACTATACTACCGTGCGGAATCGGATCGACGAGGCTCAGCCCGGAAAGCCCAAGGGAGCTATGAGCGGGTCGCC
TGCAGGTCCTCTTCTATACCAGGCGCGTCGGCGGACTTTGGCCGTGTGCAATCTCCTCGCATTCGTGGTGTTCAC
TCTTTGGCCTTGCATGCCACCTCGGTTACTGAGTGATACAGCCGTGGATGGTGACGAGGGAGATCTAGCCCGCAG
TTATGGGTTCGTGGACACGGTGCATGGTATCAAGGGATCGGGCAGTGTGTGGACCGAAAACCGCTTCTGTAACCA
ATATGGCAAGTGTTGTCTGGAATTCTCTCTATGAATCCTTGGCTAACTGTTACCAGCGGCGATGCCTTCCTTGCA
TTTCGGCTACTCTTTATTGATCGGCCTCACACTGATCACAATCCCTTTGCCGCAGCACCACCGGCACACAATCCT
GCGTACTCGGCTGACCCGTGCCTTAAGACTGGAGCTCCCGTCGTGGCGCCGCCTCGTTTGCGTCATACTCGGCTT
CCTATATCCGTTTACCATCCTTGTAGCTATTGTTGCCACTGCCAACCATTTTATTCTGGATGCTGTCGCAGGAGC
GCTTGTATGTGCCTTGGGGTGGTATTTTAATGGGGTGCTGCTCAACCTGTTGCCACTGGAAGACTACTTCCTTTG
CCTTGTCCGGATCCATAAGCCTGAGCCGTCACTTCTCGATGTCCACGAGGAGGAGTGTCCCACGACCGAAAGTGT
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail