Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g9206.t1
Gene name
Locationscaffold_25:67123..68343
Strand+
Gene length (bp)1220
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 3.6E-54 8 359

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g9206.t1
MAVLPLTVRPLQPPPGSSIDFGAEVEGVDLENLTEEQFATIRKALYEHQVVVFKNQKGLSPKAQYELTKRFDPVS
ENYGHGKTIDAKRSILHPDLKTVPHQPQVQVIGNGHVDSYEGLKDITLRHPHHRTFHKDHIPDDKDYDFTRFYRW
HIDAALYDLYPPQVTTLMAVSVPKGRRQTLLYDDGTGETMDVPLGTTAFVSGERMFELLSPEDKEFVKTSKIEYA
PHPYIWMSQAHSRPTGLGLHSEGLELPDSELPPIDPSKIMVFPMTWKNPVTGKLALQIHPSAVRRIHCADGTTID
DLARVRDIVYKLQRPAISPQYVYPHDWEDNDLVLFNNRGVLHSVVGAFKPDEVRLFRQCNLAASEPPVGA*
Coding >Pro_DTO070G2_2|g9206.t1
ATGGCTGTGTTACCACTTACCGTCCGTCCGCTTCAGCCTCCTCCGGGCTCAAGCATTGATTTTGGTGCTGAGGTT
GAAGGTGTTGATTTGGAAAACTTGACTGAAGAGCAGTTTGCCACTATTCGGAAAGCCCTCTACGAGCACCAGGTT
GTGGTGTTCAAAAACCAGAAAGGGCTATCACCTAAAGCCCAGTATGAGCTGACCAAGCGATTCGACCCGGTTTCC
GAAAACTATGGACATGGCAAGACCATTGATGCGAAGCGAAGCATCCTCCATCCTGACCTCAAGACTGTCCCTCAC
CAGCCACAGGTGCAGGTGATCGGAAATGGACATGTTGATTCGTACGAGGGTCTCAAAGATATCACATTACGACAC
CCTCACCACCGCACATTCCACAAAGATCACATCCCGGACGATAAGGACTATGATTTTACCCGGTTTTACCGCTGG
CATATCGATGCCGCCCTTTACGACCTATACCCGCCCCAGGTGACAACGCTTATGGCCGTAAGTGTGCCCAAAGGC
CGCCGACAGACATTATTGTATGATGATGGAACCGGGGAAACAATGGATGTACCACTTGGGACAACAGCGTTTGTT
AGCGGAGAGCGGATGTTTGAACTTCTTTCGCCCGAGGATAAGGAGTTTGTGAAGACAAGCAAAATTGAATATGCC
CCCCATCCGTACATTTGGATGAGCCAAGCGCATTCCCGACCTACGGGGCTCGGTCTACACTCAGAAGGACTCGAG
TTGCCTGACTCGGAACTTCCACCTATCGACCCTAGTAAGATCATGGTTTTCCCAATGACCTGGAAAAACCCAGTG
ACGGGCAAATTGGCTCTCCAGATCCATCCCTCTGCTGTACGGCGTATCCACTGCGCCGATGGAACCACGATCGAT
GACTTGGCCCGTGTACGGGACATTGTCTATAAGTTGCAGCGGCCGGCCATCAGCCCTCAGTATGTATATCCCCAT
GACTGGGAAGATAACGACTTGGTTTTATTCAACAACCGTGGCGTGCTGCATTCCGTGGTTGGTGCATTCAAACCC
GACGAAGTGCGACTGTTCCGTCAATGTAACTTGGCGGCTTCGGAGCCACCAGTTGGGGCATGA
Transcript >Pro_DTO070G2_2|g9206.t1
ATGGCTGTGTTACCACTTACCGTCCGTCCGCTTCAGCCTCCTCCGGGCTCAAGCATTGATTTTGGTGCTGAGGTT
GAAGGTGTTGATTTGGAAAACTTGACTGAAGAGCAGTTTGCCACTATTCGGAAAGCCCTCTACGAGCACCAGGTT
GTGGTGTTCAAAAACCAGAAAGGGCTATCACCTAAAGCCCAGTATGAGCTGACCAAGCGATTCGACCCGGTTTCC
GAAAACTATGGACATGGCAAGACCATTGATGCGAAGCGAAGCATCCTCCATCCTGACCTCAAGACTGTCCCTCAC
CAGCCACAGGTGCAGGTGATCGGAAATGGACATGTTGATTCGTACGAGGGTCTCAAAGATATCACATTACGACAC
CCTCACCACCGCACATTCCACAAAGATCACATCCCGGACGATAAGGACTATGATTTTACCCGGTTTTACCGCTGG
CATATCGATGCCGCCCTTTACGACCTATACCCGCCCCAGGTGACAACGCTTATGGCCGTAAGTGTGCCCAAAGGC
CGCCGACAGACATTATTGTATGATGATGGAACCGGGGAAACAATGGATGTACCACTTGGGACAACAGCGTTTGTT
AGCGGAGAGCGGATGTTTGAACTTCTTTCGCCCGAGGATAAGGAGTTTGTGAAGACAAGCAAAATTGAATATGCC
CCCCATCCGTACATTTGGATGAGCCAAGCGCATTCCCGACCTACGGGGCTCGGTCTACACTCAGAAGGACTCGAG
TTGCCTGACTCGGAACTTCCACCTATCGACCCTAGTAAGATCATGGTTTTCCCAATGACCTGGAAAAACCCAGTG
ACGGGCAAATTGGCTCTCCAGATCCATCCCTCTGCTGTACGGCGTATCCACTGCGCCGATGGAACCACGATCGAT
GACTTGGCCCGTGTACGGGACATTGTCTATAAGTTGCAGCGGCCGGCCATCAGCCCTCAGTATGTATATCCCCAT
GACTGGGAAGATAACGACTTGGTTTTATTCAACAACCGTGGCGTGCTGCATTCCGTGGTTGGTGCATTCAAACCC
GACGAAGTGCGACTGTTCCGTCAATGTAACTTGGCGGCTTCGGAGCCACCAGTTGGGGCATGA
Gene >Pro_DTO070G2_2|g9206.t1
ATGGCTGTGTTACCACTTACCGTCCGTCCGCTTCAGCCTCCTCCGGGCTCAAGCATTGATTTTGGTGCTGAGGTT
GAAGGTGTTGATTTGGAAAACTTGACTGGTTTGTGGATTACTGCCAATTATAAGAGCACAAGCTAATGGTCATAT
AGAAGAGCAGTTTGCCACTATTCGGAAAGCCCTCTACGAGCACCAGGTTGTGGTGTTCAAAAACCAGAAAGGGCT
ATCACCTAAAGCCCAGTATGAGCTGACCAAGCGATTCGACCCGGTTTCCGAAAACTATGGACATGGCAAGACCAT
TGATGCGAAGCGAAGCATCCTCCATCCTGACCTCAAGACTGTCCCTCACCAGCCACAGGTGCAGGTGATCGGAAA
TGGACATGTTGATTCGTACGAGGGTCTCAAAGATATCACATTACGACACCCTCACCACCGCACATTCCACAAAGA
TCACATCCCGGACGATAAGGACTATGATTTTACCCGGTTTTACCGCTGGCATATCGATGCCGCCCTTTACGACCT
ATACCCGCCCCAGGTGACAACGCTTATGGCCGTAAGTGTGCCCAAAGGCCGCCGACAGACATTATTGTATGATGA
TGGAACCGGGGAAACAATGGATGTACCACTTGGGACAACAGCGTTTGTTAGCGGAGAGCGGATGTTTGAACTTCT
TTCGCCCGAGGATAAGGAGTTTGTGAAGACAAGCAAAATTGAATATGCCCCCCATCCGTAAGATCCCTTATGGTA
TTCCCATGGCTCTGATCAACTGAGCTAAATATCACAACAGGTACATTTGGATGAGCCAAGCGCATTCCCGACCTA
CGGGGCTCGGTCTACACTCAGAAGGACTCGAGTTGCCTGACTCGGAACTTCCACCTATCGACCCTAGTAAGATCA
TGGTTTTCCCAATGACCTGGAAAAACCCAGTGACGGGCAAATTGGCTCTCCAGATCCATCCCTCTGCTGTACGGC
GTATCCACTGCGCCGATGGAACCACGATCGATGACTTGGCCCGTGTACGGGACATTGTCTATAAGTTGCAGCGGC
CGGCCATCAGCCCTCAGTATGTATATCCCCATGACTGGGAAGATAACGACTTGGTTTTATTCAACAACCGTGGCG
TGCTGCATTCCGTGGTTGGTGCATTCAAACCCGACGAAGTGCGACTGTTCCGTCAATGTAACTTGGCGGCTTCGG
AGCCACCAGTTGGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail