Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g9112.t1
Gene name
Locationscaffold_24:86835..87700
Strand-
Gene length (bp)865
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 2.8E-16 31 107

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g9112.t1
MYFSKGVIAVTASFVSLGLAADPLSFTSWPKEPLQPGKPVTLTWTGATPGQPVTILLRQGSSGDLQDVKPITTDG
KGGTFTWTPDNDVKSGDTYAFQILQKDQTNYTALLKSAGKPAADIPEAKDTTETGTATSTAAATGTSTGATDTST
GTSGTTTGTENTTGTSTGTTAQTTDAPNTQTTGTTETTHGTHTTMTSTASKALINSAVNSSGSPSSSSHVSSTDK
PMATSTEVVDGKKASSTGSVQTGAASIPQYSVQLVMGIAGLLACLV*
Coding >Pro_DTO070G2_2|g9112.t1
ATGTATTTCTCCAAGGGTGTTATTGCCGTGACGGCTTCCTTCGTGTCCCTTGGTCTCGCTGCCGACCCTCTATCC
TTCACTTCCTGGCCCAAGGAGCCTCTCCAACCTGGCAAGCCGGTCACCCTCACATGGACTGGTGCGACTCCTGGT
CAGCCTGTGACCATCCTCCTCCGCCAAGGTTCCTCGGGCGATCTGCAGGATGTCAAGCCAATCACTACCGATGGA
AAGGGCGGCACCTTCACCTGGACTCCTGACAACGATGTCAAATCGGGCGACACCTATGCCTTCCAAATCTTGCAG
AAAGACCAGACTAACTATACCGCTCTGCTTAAGTCGGCCGGCAAGCCCGCGGCCGATATTCCCGAGGCTAAGGAT
ACCACCGAAACTGGCACTGCTACTTCTACTGCTGCAGCCACCGGTACCTCTACTGGTGCTACTGATACCTCCACT
GGTACTTCTGGCACCACCACTGGCACCGAAAACACTACTGGCACTAGTACTGGTACCACTGCCCAGACCACTGAT
GCCCCTAACACCCAGACCACTGGTACTACCGAAACAACGCATGGAACCCACACCACAATGACTAGCACTGCCAGC
AAGGCCCTCATCAACTCTGCTGTCAACTCATCAGGCAGCCCTTCTAGCTCTTCTCACGTCAGCTCAACCGATAAG
CCGATGGCTACCAGCACCGAGGTTGTCGATGGTAAAAAAGCATCCTCAACCGGAAGCGTGCAGACTGGTGCTGCT
TCTATCCCACAATACTCCGTGCAATTGGTGATGGGTATTGCCGGTCTTTTGGCCTGCCTTGTCTAG
Transcript >Pro_DTO070G2_2|g9112.t1
ATGTATTTCTCCAAGGGTGTTATTGCCGTGACGGCTTCCTTCGTGTCCCTTGGTCTCGCTGCCGACCCTCTATCC
TTCACTTCCTGGCCCAAGGAGCCTCTCCAACCTGGCAAGCCGGTCACCCTCACATGGACTGGTGCGACTCCTGGT
CAGCCTGTGACCATCCTCCTCCGCCAAGGTTCCTCGGGCGATCTGCAGGATGTCAAGCCAATCACTACCGATGGA
AAGGGCGGCACCTTCACCTGGACTCCTGACAACGATGTCAAATCGGGCGACACCTATGCCTTCCAAATCTTGCAG
AAAGACCAGACTAACTATACCGCTCTGCTTAAGTCGGCCGGCAAGCCCGCGGCCGATATTCCCGAGGCTAAGGAT
ACCACCGAAACTGGCACTGCTACTTCTACTGCTGCAGCCACCGGTACCTCTACTGGTGCTACTGATACCTCCACT
GGTACTTCTGGCACCACCACTGGCACCGAAAACACTACTGGCACTAGTACTGGTACCACTGCCCAGACCACTGAT
GCCCCTAACACCCAGACCACTGGTACTACCGAAACAACGCATGGAACCCACACCACAATGACTAGCACTGCCAGC
AAGGCCCTCATCAACTCTGCTGTCAACTCATCAGGCAGCCCTTCTAGCTCTTCTCACGTCAGCTCAACCGATAAG
CCGATGGCTACCAGCACCGAGGTTGTCGATGGTAAAAAAGCATCCTCAACCGGAAGCGTGCAGACTGGTGCTGCT
TCTATCCCACAATACTCCGTGCAATTGGTGATGGGTATTGCCGGTCTTTTGGCCTGCCTTGTCTAG
Gene >Pro_DTO070G2_2|g9112.t1
ATGTATTTCTCCAAGGGTGTTATTGCCGTGACGGCTTCCTTCGTGTCCCTTGGTCTCGCTGCCGACCCTCTATCC
TTCACTTCCTGGCCCAAGGAGCCTCTCCAACCTGGCAAGCCGGTCACCCTCACATGGACTGGTGCGACTCCTGGT
CAGGTAATACGCATCTTTTCCAATGTCTCATAACAAATCTGACCCCGTTTAGCCTGTGACCATCCTCCTCCGCCA
AGGTTCCTCGGGCGATCTGCAGGATGTCAAGCCAATCACTACCGATGGAAAGGGCGGCACCTTCACCTGGACTCC
TGACAACGATGTCAAATCGGGCGACACCTATGCCTTCCAAATCTTGCAGAAAGACCAGACTAACTATACCGCTCT
GCTTAAGTCGGCCGGCAAGCCCGCGGCCGATATTCCCGAGGCTAAGGATACCACCGAAACTGGCACTGCTACTTC
TACTGCTGCAGCCACCGGTACCTCTACTGGTGCTACTGATACCTCCACTGGTACTTCTGGCACCACCACTGGCAC
CGAAAACACTACTGGCACTAGTACTGGTACCACTGCCCAGACCACTGATGCCCCTAACACCCAGACCACTGGTAC
TACCGAAACAACGCATGGAACCCACACCACAATGACTAGCACTGCCAGCAAGGCCCTCATCAACTCTGCTGTCAA
CTCATCAGGCAGCCCTTCTAGCTCTTCTCACGTCAGCTCAACCGATAAGCCGATGGCTACCAGCACCGAGGTTGT
CGATGGTAAAAAAGCATCCTCAACCGGAAGCGTGCAGACTGGTGCTGCTTCTATCCCACAATACTCCGTGCAATT
GGTGATGGGTATTGCCGGTCTTTTGGCCTGCCTTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail