Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8986.t1
Gene name
Locationscaffold_22:285746..289313
Strand-
Gene length (bp)3567
Transcript length (bp)3567
Coding sequence length (bp)3567
Protein length (aa) 1189

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 7.1E-47 629 811
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 8.3E-32 829 1076
PF00403 HMA Heavy-metal-associated domain 1.1E-12 179 239
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 4.3E-05 1039 1099

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 442 464 22
2 537 556 19
3 571 590 19
4 733 755 22
5 775 797 22
6 1122 1144 22
7 1154 1175 21

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup9838
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g9730.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g9970.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g9862.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g10162.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g9333.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g9625.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g9338.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g8986.t1 (this protein)
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g9408.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g9300.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g5982.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g3684.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g9527.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g9528.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g9842.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9673.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g3237.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8986.t1
MAPSDKLSLPQSRLTTILVNNLHCPSCVTNVEETLSALKPPPFSISTSILRHEIEIVHSVTLSADRIVRALEDVA
FEVDSVIPDASEGDIEANAAEAQRRSSRGELEHDVLAQSELHLSKCDACSAQLDMLSSKTSSTVHKEAVADKKDQ
LGRHVGQTKEEALVSVMDDHLIDTRARVTLSVSGMSCSSCVSKITGVLQTRPWVQSADVNLLTNSAVVMLLDKSH
IDELLETVRETGYTTELIECEEIRLQQPSSASGLEDTWRASYVIQGMTCSSCVGKVTDTLKQYGWITTVDVNLIS
ASAMVEFQGKDHLDEIPGIINSLGYTATLGDVESRATSSQPSSKRSVTIQVEGMHCPRCPQRILDALAVYSDRLK
VTAPPSKTQPKITVSYLPEAPKFTIRHIMSTIADIDKAFTVSVYHPPSLEERSQAMHRRHQWHIARRLILAVLAA
IPTFIIGVVYMSLVNNDNPGRIYLEEPMWSGEASRSEWALFITSSPVYFFAADIFHRRMLTELKALWRPGSKTPI
LRRFYRFGSMDMLMSLGTSIAYFSSIAILAINASQPHGSPKASHTGSYFDAVVFLTMFLLIGRLLEAYSKAKAGN
AVSLLGKLRPTEATLVDTAGAGSLSASANSSTVPIDQLEFGDVVRVANGASPPYDGTVINGESQFDESSLTGESR
PVSKSIGDEVFSGTVNQANPVLVRVTHLSGDSMLDQIINTVRQGQVRRAPIERTADLITGFFVPVITLIAVLDWV
IWLGLGVSSRLPDSWKANTPGGWGFWSLQFAISVFVVACPCGIGLAAPTALFVGGGLAAQHGILVKGGGEAFQEA
SQLDCIVFDKTGTITKGGEPSITDHEVTHSAGVDDLWGAVMELEQNSNHPIAKAVVIFTASKLAPVLKAIMVDEI
PGKGMKGSFGARNRVSSVLEVIVGNEALMQDHGIVIPSASAEKLSAWKRQAKSVVLVGHRIRPEQSATEIVPWKL
SIMLAVADPIRIEAKGTIKAIQDRGIAVWMISGDNPTTAHAVGSMVGIPPENILAGILPEQKAEKIRYLQNTLQK
ETGSARALVAMVGDGVNDSPALTAADVGIAIGSGSDIAISAAEFVLVSSRLSSLLTLIDLSRVVFRRIKFNFVWA
LVYNCIAVPVAAGVFYPIVSNGSHVRLDPVWSSLAMALSSVSVVSSSLLMKARLPLVGFRSDD*
Coding >Pro_DTO070G2_2|g8986.t1
ATGGCTCCGAGTGATAAGTTGTCGCTGCCTCAGTCGAGGCTGACCACCATCTTAGTCAACAATTTGCACTGCCCG
TCGTGCGTGACAAACGTCGAGGAGACTCTTTCAGCTCTAAAGCCGCCTCCTTTTTCCATTTCGACATCTATTCTT
CGACATGAGATCGAAATCGTGCACTCCGTTACGCTTAGCGCCGACCGCATCGTACGCGCTCTAGAGGATGTTGCC
TTCGAGGTTGACAGTGTTATTCCCGATGCCAGCGAGGGTGATATCGAGGCCAACGCCGCAGAAGCTCAAAGAAGA
AGCTCCCGTGGCGAGCTCGAACACGACGTCCTTGCTCAGTCCGAATTGCACCTCTCAAAATGCGACGCATGTTCC
GCACAGCTCGATATGCTGTCGTCGAAGACGTCCTCTACCGTTCACAAGGAAGCAGTCGCCGACAAAAAAGATCAG
CTCGGTCGACACGTCGGTCAGACAAAAGAAGAAGCGCTCGTGTCCGTTATGGATGACCACCTCATCGACACTCGG
GCGCGAGTCACATTGTCCGTCAGTGGGATGTCATGCAGCTCCTGTGTGAGCAAGATCACCGGGGTCTTGCAAACT
CGACCGTGGGTACAATCGGCCGACGTCAATCTCTTGACGAACAGTGCCGTTGTCATGCTCCTGGATAAGTCGCAC
ATAGATGAGTTGCTCGAGACGGTTAGGGAAACGGGTTATACCACGGAGTTGATCGAATGTGAGGAGATCCGACTC
CAGCAGCCATCGAGTGCGTCCGGACTGGAAGACACGTGGCGAGCTTCGTACGTCATCCAAGGCATGACCTGTAGC
TCCTGCGTCGGGAAAGTGACCGACACGCTGAAACAGTACGGGTGGATCACCACAGTGGATGTGAACCTCATCTCC
GCTAGTGCGATGGTGGAGTTCCAAGGGAAGGACCACCTGGACGAGATTCCTGGCATTATCAACAGCCTTGGTTAC
ACGGCCACCCTCGGCGACGTCGAGAGCAGAGCCACATCTAGTCAACCCAGCTCGAAGCGGTCGGTGACCATCCAG
GTGGAGGGGATGCACTGTCCACGCTGTCCACAGCGGATTCTCGATGCCCTCGCCGTCTACTCGGACAGATTAAAA
GTGACCGCGCCTCCTAGCAAGACACAGCCGAAGATTACTGTGAGCTATCTGCCTGAGGCGCCAAAATTTACCATC
CGACATATCATGAGCACGATTGCCGATATCGATAAAGCCTTTACCGTTTCAGTGTACCACCCTCCGAGCCTTGAG
GAACGCTCTCAGGCGATGCATCGCCGGCATCAATGGCATATCGCTCGCCGGTTGATTTTGGCCGTGCTAGCTGCC
ATCCCGACTTTTATCATCGGTGTGGTGTATATGTCCCTGGTCAACAACGACAATCCCGGTCGGATTTACCTCGAG
GAGCCTATGTGGTCAGGTGAAGCATCACGCTCTGAGTGGGCGCTCTTCATCACGTCGAGTCCTGTCTATTTCTTC
GCTGCAGACATTTTCCACCGCCGCATGCTCACCGAGCTCAAGGCGCTCTGGCGACCCGGAAGCAAAACTCCTATC
TTGCGTAGATTCTATCGCTTTGGAAGTATGGATATGCTTATGTCACTGGGCACTAGCATCGCCTACTTCTCCTCC
ATCGCTATCCTGGCCATCAATGCCTCGCAGCCACACGGTAGCCCCAAAGCTTCTCATACCGGCTCGTACTTCGAT
GCGGTTGTTTTTTTGACCATGTTCCTACTGATCGGCCGGTTGCTCGAGGCCTACAGCAAAGCCAAAGCGGGAAAT
GCAGTTAGCCTCCTGGGCAAGCTGCGCCCGACAGAGGCCACACTTGTGGACACGGCCGGAGCGGGTAGCCTCTCC
GCCTCTGCGAATTCCAGCACAGTTCCAATCGACCAACTGGAGTTCGGAGATGTGGTGCGGGTGGCGAACGGTGCC
TCACCTCCGTATGACGGAACGGTGATCAACGGAGAGTCACAGTTTGATGAGTCGAGTCTGACTGGGGAATCAAGA
CCGGTCTCCAAGTCCATTGGAGACGAAGTTTTTTCGGGAACAGTCAACCAGGCAAACCCGGTCTTGGTCCGTGTC
ACCCATCTTTCAGGCGACTCGATGTTGGATCAGATCATCAACACCGTTCGCCAGGGGCAGGTCCGTCGAGCGCCA
ATCGAGCGCACGGCAGACTTGATTACGGGGTTTTTTGTTCCCGTCATCACCCTCATCGCGGTGTTGGACTGGGTG
ATTTGGCTAGGCCTTGGTGTCTCCAGCCGGTTGCCCGACTCCTGGAAGGCCAACACTCCGGGAGGCTGGGGTTTC
TGGTCGTTGCAATTCGCCATCTCAGTTTTTGTTGTCGCGTGCCCCTGTGGTATCGGACTCGCAGCGCCGACGGCC
CTTTTTGTCGGTGGTGGTCTCGCGGCTCAGCATGGGATCCTCGTCAAAGGTGGGGGTGAAGCCTTCCAGGAGGCC
AGCCAGCTTGACTGCATCGTCTTCGATAAGACCGGCACCATTACCAAGGGCGGCGAACCTTCTATCACTGATCAT
GAGGTAACACATAGCGCAGGCGTCGATGATCTTTGGGGCGCCGTTATGGAGCTCGAACAGAACAGCAATCACCCG
ATTGCTAAGGCGGTTGTGATTTTTACCGCCTCCAAGCTAGCACCGGTCCTCAAAGCGATTATGGTGGATGAAATA
CCAGGAAAGGGTATGAAAGGCTCATTCGGCGCTCGCAATCGGGTCTCATCTGTCCTGGAAGTCATCGTGGGCAAT
GAGGCCTTGATGCAAGATCACGGAATCGTCATCCCTTCGGCCAGTGCCGAAAAATTGAGCGCCTGGAAGCGCCAG
GCCAAGTCTGTGGTCCTGGTAGGGCACAGAATCCGCCCGGAGCAATCAGCCACCGAAATAGTCCCCTGGAAGCTC
TCCATCATGTTGGCAGTAGCCGACCCCATCCGGATCGAGGCCAAGGGGACCATCAAGGCTATCCAGGATCGGGGT
ATCGCGGTGTGGATGATATCAGGAGATAACCCGACGACCGCGCATGCGGTGGGCAGCATGGTCGGAATCCCGCCA
GAGAACATCCTTGCCGGTATTCTGCCCGAGCAAAAGGCAGAAAAGATTCGATATCTCCAGAACACCCTACAGAAG
GAAACAGGCTCCGCCCGGGCACTTGTCGCGATGGTTGGTGATGGGGTTAACGATTCGCCTGCGCTAACCGCGGCC
GACGTCGGCATTGCAATTGGTTCAGGGTCGGACATTGCGATCTCGGCTGCAGAGTTTGTCCTCGTGTCTTCTCGT
CTCTCTTCTCTCCTGACGCTCATCGATCTAAGCCGCGTCGTTTTCCGCCGGATCAAGTTTAACTTCGTCTGGGCG
CTGGTTTACAACTGCATTGCCGTGCCAGTCGCTGCGGGAGTGTTTTACCCAATCGTCAGCAACGGCAGCCATGTC
CGGTTGGATCCAGTCTGGTCCAGCCTCGCGATGGCATTGAGCAGTGTCAGTGTCGTATCCAGCAGTCTTTTGATG
AAGGCTCGACTGCCACTGGTCGGTTTCAGATCGGATGATTGA
Transcript >Pro_DTO070G2_2|g8986.t1
ATGGCTCCGAGTGATAAGTTGTCGCTGCCTCAGTCGAGGCTGACCACCATCTTAGTCAACAATTTGCACTGCCCG
TCGTGCGTGACAAACGTCGAGGAGACTCTTTCAGCTCTAAAGCCGCCTCCTTTTTCCATTTCGACATCTATTCTT
CGACATGAGATCGAAATCGTGCACTCCGTTACGCTTAGCGCCGACCGCATCGTACGCGCTCTAGAGGATGTTGCC
TTCGAGGTTGACAGTGTTATTCCCGATGCCAGCGAGGGTGATATCGAGGCCAACGCCGCAGAAGCTCAAAGAAGA
AGCTCCCGTGGCGAGCTCGAACACGACGTCCTTGCTCAGTCCGAATTGCACCTCTCAAAATGCGACGCATGTTCC
GCACAGCTCGATATGCTGTCGTCGAAGACGTCCTCTACCGTTCACAAGGAAGCAGTCGCCGACAAAAAAGATCAG
CTCGGTCGACACGTCGGTCAGACAAAAGAAGAAGCGCTCGTGTCCGTTATGGATGACCACCTCATCGACACTCGG
GCGCGAGTCACATTGTCCGTCAGTGGGATGTCATGCAGCTCCTGTGTGAGCAAGATCACCGGGGTCTTGCAAACT
CGACCGTGGGTACAATCGGCCGACGTCAATCTCTTGACGAACAGTGCCGTTGTCATGCTCCTGGATAAGTCGCAC
ATAGATGAGTTGCTCGAGACGGTTAGGGAAACGGGTTATACCACGGAGTTGATCGAATGTGAGGAGATCCGACTC
CAGCAGCCATCGAGTGCGTCCGGACTGGAAGACACGTGGCGAGCTTCGTACGTCATCCAAGGCATGACCTGTAGC
TCCTGCGTCGGGAAAGTGACCGACACGCTGAAACAGTACGGGTGGATCACCACAGTGGATGTGAACCTCATCTCC
GCTAGTGCGATGGTGGAGTTCCAAGGGAAGGACCACCTGGACGAGATTCCTGGCATTATCAACAGCCTTGGTTAC
ACGGCCACCCTCGGCGACGTCGAGAGCAGAGCCACATCTAGTCAACCCAGCTCGAAGCGGTCGGTGACCATCCAG
GTGGAGGGGATGCACTGTCCACGCTGTCCACAGCGGATTCTCGATGCCCTCGCCGTCTACTCGGACAGATTAAAA
GTGACCGCGCCTCCTAGCAAGACACAGCCGAAGATTACTGTGAGCTATCTGCCTGAGGCGCCAAAATTTACCATC
CGACATATCATGAGCACGATTGCCGATATCGATAAAGCCTTTACCGTTTCAGTGTACCACCCTCCGAGCCTTGAG
GAACGCTCTCAGGCGATGCATCGCCGGCATCAATGGCATATCGCTCGCCGGTTGATTTTGGCCGTGCTAGCTGCC
ATCCCGACTTTTATCATCGGTGTGGTGTATATGTCCCTGGTCAACAACGACAATCCCGGTCGGATTTACCTCGAG
GAGCCTATGTGGTCAGGTGAAGCATCACGCTCTGAGTGGGCGCTCTTCATCACGTCGAGTCCTGTCTATTTCTTC
GCTGCAGACATTTTCCACCGCCGCATGCTCACCGAGCTCAAGGCGCTCTGGCGACCCGGAAGCAAAACTCCTATC
TTGCGTAGATTCTATCGCTTTGGAAGTATGGATATGCTTATGTCACTGGGCACTAGCATCGCCTACTTCTCCTCC
ATCGCTATCCTGGCCATCAATGCCTCGCAGCCACACGGTAGCCCCAAAGCTTCTCATACCGGCTCGTACTTCGAT
GCGGTTGTTTTTTTGACCATGTTCCTACTGATCGGCCGGTTGCTCGAGGCCTACAGCAAAGCCAAAGCGGGAAAT
GCAGTTAGCCTCCTGGGCAAGCTGCGCCCGACAGAGGCCACACTTGTGGACACGGCCGGAGCGGGTAGCCTCTCC
GCCTCTGCGAATTCCAGCACAGTTCCAATCGACCAACTGGAGTTCGGAGATGTGGTGCGGGTGGCGAACGGTGCC
TCACCTCCGTATGACGGAACGGTGATCAACGGAGAGTCACAGTTTGATGAGTCGAGTCTGACTGGGGAATCAAGA
CCGGTCTCCAAGTCCATTGGAGACGAAGTTTTTTCGGGAACAGTCAACCAGGCAAACCCGGTCTTGGTCCGTGTC
ACCCATCTTTCAGGCGACTCGATGTTGGATCAGATCATCAACACCGTTCGCCAGGGGCAGGTCCGTCGAGCGCCA
ATCGAGCGCACGGCAGACTTGATTACGGGGTTTTTTGTTCCCGTCATCACCCTCATCGCGGTGTTGGACTGGGTG
ATTTGGCTAGGCCTTGGTGTCTCCAGCCGGTTGCCCGACTCCTGGAAGGCCAACACTCCGGGAGGCTGGGGTTTC
TGGTCGTTGCAATTCGCCATCTCAGTTTTTGTTGTCGCGTGCCCCTGTGGTATCGGACTCGCAGCGCCGACGGCC
CTTTTTGTCGGTGGTGGTCTCGCGGCTCAGCATGGGATCCTCGTCAAAGGTGGGGGTGAAGCCTTCCAGGAGGCC
AGCCAGCTTGACTGCATCGTCTTCGATAAGACCGGCACCATTACCAAGGGCGGCGAACCTTCTATCACTGATCAT
GAGGTAACACATAGCGCAGGCGTCGATGATCTTTGGGGCGCCGTTATGGAGCTCGAACAGAACAGCAATCACCCG
ATTGCTAAGGCGGTTGTGATTTTTACCGCCTCCAAGCTAGCACCGGTCCTCAAAGCGATTATGGTGGATGAAATA
CCAGGAAAGGGTATGAAAGGCTCATTCGGCGCTCGCAATCGGGTCTCATCTGTCCTGGAAGTCATCGTGGGCAAT
GAGGCCTTGATGCAAGATCACGGAATCGTCATCCCTTCGGCCAGTGCCGAAAAATTGAGCGCCTGGAAGCGCCAG
GCCAAGTCTGTGGTCCTGGTAGGGCACAGAATCCGCCCGGAGCAATCAGCCACCGAAATAGTCCCCTGGAAGCTC
TCCATCATGTTGGCAGTAGCCGACCCCATCCGGATCGAGGCCAAGGGGACCATCAAGGCTATCCAGGATCGGGGT
ATCGCGGTGTGGATGATATCAGGAGATAACCCGACGACCGCGCATGCGGTGGGCAGCATGGTCGGAATCCCGCCA
GAGAACATCCTTGCCGGTATTCTGCCCGAGCAAAAGGCAGAAAAGATTCGATATCTCCAGAACACCCTACAGAAG
GAAACAGGCTCCGCCCGGGCACTTGTCGCGATGGTTGGTGATGGGGTTAACGATTCGCCTGCGCTAACCGCGGCC
GACGTCGGCATTGCAATTGGTTCAGGGTCGGACATTGCGATCTCGGCTGCAGAGTTTGTCCTCGTGTCTTCTCGT
CTCTCTTCTCTCCTGACGCTCATCGATCTAAGCCGCGTCGTTTTCCGCCGGATCAAGTTTAACTTCGTCTGGGCG
CTGGTTTACAACTGCATTGCCGTGCCAGTCGCTGCGGGAGTGTTTTACCCAATCGTCAGCAACGGCAGCCATGTC
CGGTTGGATCCAGTCTGGTCCAGCCTCGCGATGGCATTGAGCAGTGTCAGTGTCGTATCCAGCAGTCTTTTGATG
AAGGCTCGACTGCCACTGGTCGGTTTCAGATCGGATGATTGA
Gene >Pro_DTO070G2_2|g8986.t1
ATGGCTCCGAGTGATAAGTTGTCGCTGCCTCAGTCGAGGCTGACCACCATCTTAGTCAACAATTTGCACTGCCCG
TCGTGCGTGACAAACGTCGAGGAGACTCTTTCAGCTCTAAAGCCGCCTCCTTTTTCCATTTCGACATCTATTCTT
CGACATGAGATCGAAATCGTGCACTCCGTTACGCTTAGCGCCGACCGCATCGTACGCGCTCTAGAGGATGTTGCC
TTCGAGGTTGACAGTGTTATTCCCGATGCCAGCGAGGGTGATATCGAGGCCAACGCCGCAGAAGCTCAAAGAAGA
AGCTCCCGTGGCGAGCTCGAACACGACGTCCTTGCTCAGTCCGAATTGCACCTCTCAAAATGCGACGCATGTTCC
GCACAGCTCGATATGCTGTCGTCGAAGACGTCCTCTACCGTTCACAAGGAAGCAGTCGCCGACAAAAAAGATCAG
CTCGGTCGACACGTCGGTCAGACAAAAGAAGAAGCGCTCGTGTCCGTTATGGATGACCACCTCATCGACACTCGG
GCGCGAGTCACATTGTCCGTCAGTGGGATGTCATGCAGCTCCTGTGTGAGCAAGATCACCGGGGTCTTGCAAACT
CGACCGTGGGTACAATCGGCCGACGTCAATCTCTTGACGAACAGTGCCGTTGTCATGCTCCTGGATAAGTCGCAC
ATAGATGAGTTGCTCGAGACGGTTAGGGAAACGGGTTATACCACGGAGTTGATCGAATGTGAGGAGATCCGACTC
CAGCAGCCATCGAGTGCGTCCGGACTGGAAGACACGTGGCGAGCTTCGTACGTCATCCAAGGCATGACCTGTAGC
TCCTGCGTCGGGAAAGTGACCGACACGCTGAAACAGTACGGGTGGATCACCACAGTGGATGTGAACCTCATCTCC
GCTAGTGCGATGGTGGAGTTCCAAGGGAAGGACCACCTGGACGAGATTCCTGGCATTATCAACAGCCTTGGTTAC
ACGGCCACCCTCGGCGACGTCGAGAGCAGAGCCACATCTAGTCAACCCAGCTCGAAGCGGTCGGTGACCATCCAG
GTGGAGGGGATGCACTGTCCACGCTGTCCACAGCGGATTCTCGATGCCCTCGCCGTCTACTCGGACAGATTAAAA
GTGACCGCGCCTCCTAGCAAGACACAGCCGAAGATTACTGTGAGCTATCTGCCTGAGGCGCCAAAATTTACCATC
CGACATATCATGAGCACGATTGCCGATATCGATAAAGCCTTTACCGTTTCAGTGTACCACCCTCCGAGCCTTGAG
GAACGCTCTCAGGCGATGCATCGCCGGCATCAATGGCATATCGCTCGCCGGTTGATTTTGGCCGTGCTAGCTGCC
ATCCCGACTTTTATCATCGGTGTGGTGTATATGTCCCTGGTCAACAACGACAATCCCGGTCGGATTTACCTCGAG
GAGCCTATGTGGTCAGGTGAAGCATCACGCTCTGAGTGGGCGCTCTTCATCACGTCGAGTCCTGTCTATTTCTTC
GCTGCAGACATTTTCCACCGCCGCATGCTCACCGAGCTCAAGGCGCTCTGGCGACCCGGAAGCAAAACTCCTATC
TTGCGTAGATTCTATCGCTTTGGAAGTATGGATATGCTTATGTCACTGGGCACTAGCATCGCCTACTTCTCCTCC
ATCGCTATCCTGGCCATCAATGCCTCGCAGCCACACGGTAGCCCCAAAGCTTCTCATACCGGCTCGTACTTCGAT
GCGGTTGTTTTTTTGACCATGTTCCTACTGATCGGCCGGTTGCTCGAGGCCTACAGCAAAGCCAAAGCGGGAAAT
GCAGTTAGCCTCCTGGGCAAGCTGCGCCCGACAGAGGCCACACTTGTGGACACGGCCGGAGCGGGTAGCCTCTCC
GCCTCTGCGAATTCCAGCACAGTTCCAATCGACCAACTGGAGTTCGGAGATGTGGTGCGGGTGGCGAACGGTGCC
TCACCTCCGTATGACGGAACGGTGATCAACGGAGAGTCACAGTTTGATGAGTCGAGTCTGACTGGGGAATCAAGA
CCGGTCTCCAAGTCCATTGGAGACGAAGTTTTTTCGGGAACAGTCAACCAGGCAAACCCGGTCTTGGTCCGTGTC
ACCCATCTTTCAGGCGACTCGATGTTGGATCAGATCATCAACACCGTTCGCCAGGGGCAGGTCCGTCGAGCGCCA
ATCGAGCGCACGGCAGACTTGATTACGGGGTTTTTTGTTCCCGTCATCACCCTCATCGCGGTGTTGGACTGGGTG
ATTTGGCTAGGCCTTGGTGTCTCCAGCCGGTTGCCCGACTCCTGGAAGGCCAACACTCCGGGAGGCTGGGGTTTC
TGGTCGTTGCAATTCGCCATCTCAGTTTTTGTTGTCGCGTGCCCCTGTGGTATCGGACTCGCAGCGCCGACGGCC
CTTTTTGTCGGTGGTGGTCTCGCGGCTCAGCATGGGATCCTCGTCAAAGGTGGGGGTGAAGCCTTCCAGGAGGCC
AGCCAGCTTGACTGCATCGTCTTCGATAAGACCGGCACCATTACCAAGGGCGGCGAACCTTCTATCACTGATCAT
GAGGTAACACATAGCGCAGGCGTCGATGATCTTTGGGGCGCCGTTATGGAGCTCGAACAGAACAGCAATCACCCG
ATTGCTAAGGCGGTTGTGATTTTTACCGCCTCCAAGCTAGCACCGGTCCTCAAAGCGATTATGGTGGATGAAATA
CCAGGAAAGGGTATGAAAGGCTCATTCGGCGCTCGCAATCGGGTCTCATCTGTCCTGGAAGTCATCGTGGGCAAT
GAGGCCTTGATGCAAGATCACGGAATCGTCATCCCTTCGGCCAGTGCCGAAAAATTGAGCGCCTGGAAGCGCCAG
GCCAAGTCTGTGGTCCTGGTAGGGCACAGAATCCGCCCGGAGCAATCAGCCACCGAAATAGTCCCCTGGAAGCTC
TCCATCATGTTGGCAGTAGCCGACCCCATCCGGATCGAGGCCAAGGGGACCATCAAGGCTATCCAGGATCGGGGT
ATCGCGGTGTGGATGATATCAGGAGATAACCCGACGACCGCGCATGCGGTGGGCAGCATGGTCGGAATCCCGCCA
GAGAACATCCTTGCCGGTATTCTGCCCGAGCAAAAGGCAGAAAAGATTCGATATCTCCAGAACACCCTACAGAAG
GAAACAGGCTCCGCCCGGGCACTTGTCGCGATGGTTGGTGATGGGGTTAACGATTCGCCTGCGCTAACCGCGGCC
GACGTCGGCATTGCAATTGGTTCAGGGTCGGACATTGCGATCTCGGCTGCAGAGTTTGTCCTCGTGTCTTCTCGT
CTCTCTTCTCTCCTGACGCTCATCGATCTAAGCCGCGTCGTTTTCCGCCGGATCAAGTTTAACTTCGTCTGGGCG
CTGGTTTACAACTGCATTGCCGTGCCAGTCGCTGCGGGAGTGTTTTACCCAATCGTCAGCAACGGCAGCCATGTC
CGGTTGGATCCAGTCTGGTCCAGCCTCGCGATGGCATTGAGCAGTGTCAGTGTCGTATCCAGCAGTCTTTTGATG
AAGGCTCGACTGCCACTGGTCGGTTTCAGATCGGATGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail