Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8828.t1
Gene name
Locationscaffold_21:191432..192910
Strand+
Gene length (bp)1478
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 4.4E-18 125 256
PF00190 Cupin_1 Cupin 1.8E-19 297 408
PF07883 Cupin_2 Cupin domain 8.6E-11 149 221
PF07883 Cupin_2 Cupin domain 4.7E-11 327 401

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8828.t1
MQITRFLLNLAYLQAVWAIPAPDHSLQKLLQVPAGHSAALFGQQPIGKNPPFSPGHRDPYDHKVDSVGDDRHPLP
FRNGDGTTVMGPRNRDRERQNPDLVRPPSTDHGNMPNMRWSFADSHIRIEEGGWTRQTTIHELPTSRELAGVNMR
LDQGVIRELHWHTEAEWAYVLAGKVRVTALDLEGGTFMDDLEEGDLWYFPAGHPHSLQGLGENGTEFLLIFDDGN
FSEESTFILTDWLAHTPKAVLGENFRMSPEQFDNIPKSEKYIFQGSNPGSIDEEKPRTFKKSKINFTHHMLAQEP
IKTSGGRVRITDSTNFPVSKTVAAAHLEIAPGALREMHWHPNADEWTYYKKGRARVTIFAAEGNARTFNYMAGDV
GIVPRNMGHFVENLSDDEPLEVLEIFRADRFQDFSLFQWLGSSPRRMIAENIFPGDAKAAEEFLKKIEDAEKDPI
KDTI*
Coding >Pro_DTO070G2_2|g8828.t1
ATGCAAATTACACGCTTCTTGTTAAACCTGGCATATCTTCAGGCTGTATGGGCTATCCCTGCACCTGATCACAGC
CTGCAGAAGCTACTGCAGGTCCCAGCCGGCCATTCCGCAGCATTATTCGGTCAACAGCCTATTGGAAAAAACCCA
CCTTTCTCCCCAGGACATCGCGACCCATATGATCACAAGGTTGACTCTGTTGGCGATGACCGACATCCACTGCCG
TTCCGCAATGGAGATGGTACTACGGTCATGGGACCGCGGAATCGGGATCGCGAGCGCCAGAACCCCGATCTTGTC
CGTCCGCCGAGTACCGACCATGGCAATATGCCTAATATGCGATGGAGTTTTGCAGACTCACATATTCGCATCGAG
GAAGGCGGATGGACGCGACAAACAACTATCCACGAGCTACCCACTAGCCGTGAACTCGCCGGTGTGAACATGCGT
CTGGATCAAGGGGTAATCCGCGAACTGCATTGGCACACGGAAGCTGAATGGGCGTATGTGCTTGCTGGAAAAGTA
CGAGTCACAGCCCTAGACTTAGAAGGCGGTACTTTTATGGACGACTTGGAGGAAGGAGATCTGTGGTATTTCCCC
GCTGGACATCCGCATTCGCTCCAGGGTCTGGGCGAAAATGGGACAGAATTCCTGTTGATCTTTGACGATGGCAAC
TTCTCCGAAGAGTCCACCTTCATCTTGACTGATTGGTTGGCTCACACTCCCAAAGCAGTTCTAGGAGAGAACTTC
CGGATGTCACCGGAGCAATTTGACAACATCCCGAAATCCGAGAAGTACATATTCCAAGGCTCAAACCCGGGAAGC
ATTGACGAGGAGAAACCACGCACCTTCAAGAAGTCAAAGATTAACTTCACACATCATATGCTCGCCCAAGAACCC
ATTAAAACCAGCGGCGGTCGTGTCCGTATTACCGACTCCACGAACTTCCCGGTTTCCAAAACAGTAGCAGCCGCC
CATCTAGAGATTGCACCGGGCGCACTACGCGAGATGCACTGGCACCCCAACGCCGACGAATGGACATATTACAAG
AAAGGTCGTGCGCGAGTTACGATATTTGCCGCAGAAGGAAACGCCAGAACGTTCAACTACATGGCCGGTGATGTC
GGCATCGTGCCTCGGAATATGGGACACTTCGTTGAGAACCTGAGTGACGATGAACCGCTGGAGGTTTTGGAAATT
TTCCGGGCAGATCGATTCCAGGATTTCTCACTGTTCCAATGGCTTGGTAGCTCACCTCGCAGAATGATTGCCGAG
AATATATTCCCTGGCGATGCTAAGGCGGCAGAGGAATTTTTGAAAAAGATTGAAGATGCTGAAAAGGATCCCATT
AAGGATACTATCTGA
Transcript >Pro_DTO070G2_2|g8828.t1
ATGCAAATTACACGCTTCTTGTTAAACCTGGCATATCTTCAGGCTGTATGGGCTATCCCTGCACCTGATCACAGC
CTGCAGAAGCTACTGCAGGTCCCAGCCGGCCATTCCGCAGCATTATTCGGTCAACAGCCTATTGGAAAAAACCCA
CCTTTCTCCCCAGGACATCGCGACCCATATGATCACAAGGTTGACTCTGTTGGCGATGACCGACATCCACTGCCG
TTCCGCAATGGAGATGGTACTACGGTCATGGGACCGCGGAATCGGGATCGCGAGCGCCAGAACCCCGATCTTGTC
CGTCCGCCGAGTACCGACCATGGCAATATGCCTAATATGCGATGGAGTTTTGCAGACTCACATATTCGCATCGAG
GAAGGCGGATGGACGCGACAAACAACTATCCACGAGCTACCCACTAGCCGTGAACTCGCCGGTGTGAACATGCGT
CTGGATCAAGGGGTAATCCGCGAACTGCATTGGCACACGGAAGCTGAATGGGCGTATGTGCTTGCTGGAAAAGTA
CGAGTCACAGCCCTAGACTTAGAAGGCGGTACTTTTATGGACGACTTGGAGGAAGGAGATCTGTGGTATTTCCCC
GCTGGACATCCGCATTCGCTCCAGGGTCTGGGCGAAAATGGGACAGAATTCCTGTTGATCTTTGACGATGGCAAC
TTCTCCGAAGAGTCCACCTTCATCTTGACTGATTGGTTGGCTCACACTCCCAAAGCAGTTCTAGGAGAGAACTTC
CGGATGTCACCGGAGCAATTTGACAACATCCCGAAATCCGAGAAGTACATATTCCAAGGCTCAAACCCGGGAAGC
ATTGACGAGGAGAAACCACGCACCTTCAAGAAGTCAAAGATTAACTTCACACATCATATGCTCGCCCAAGAACCC
ATTAAAACCAGCGGCGGTCGTGTCCGTATTACCGACTCCACGAACTTCCCGGTTTCCAAAACAGTAGCAGCCGCC
CATCTAGAGATTGCACCGGGCGCACTACGCGAGATGCACTGGCACCCCAACGCCGACGAATGGACATATTACAAG
AAAGGTCGTGCGCGAGTTACGATATTTGCCGCAGAAGGAAACGCCAGAACGTTCAACTACATGGCCGGTGATGTC
GGCATCGTGCCTCGGAATATGGGACACTTCGTTGAGAACCTGAGTGACGATGAACCGCTGGAGGTTTTGGAAATT
TTCCGGGCAGATCGATTCCAGGATTTCTCACTGTTCCAATGGCTTGGTAGCTCACCTCGCAGAATGATTGCCGAG
AATATATTCCCTGGCGATGCTAAGGCGGCAGAGGAATTTTTGAAAAAGATTGAAGATGCTGAAAAGGATCCCATT
AAGGATACTATCTGA
Gene >Pro_DTO070G2_2|g8828.t1
ATGCAAATTACACGCTTCTTGTTAAACCTGGCATATCTTCAGGCTGTATGGGCTATCCCTGCACCTGATCACAGC
CTGCAGAAGCTACTGCAGGTCCCAGCCGGCCATTCCGCAGCATTATTCGGTCAACAGCCTATTGGAAAAAACCCA
CCTTTCTCCCCAGGACATCGCGACCCATATGATCACAAGGTTGACTCTGTTGGCGATGACCGACATCCACTGCCG
TTCCGCAATGGAGATGGTACTACGGTCATGGGACCGCGGAATCGGGATCGCGAGCGCCAGAACCCCGATCTTGTC
CGTCCGCCGAGTACCGACCATGGCAATATGCCTAATATGCGATGGAGTTTTGCAGACTCACATATTCGCATCGAG
GTATGGTCATTCTAATATGTCACGTACGTCATTAACCTAAACGTGTACGTATAGGAAGGCGGATGGACGCGACAA
ACAACTATCCACGAGCTACCCACTAGCCGTGAACTCGCCGGTGTGAACATGCGTCTGGATCAAGGGGTAATCCGC
GAACTGCATTGGCACACGGAAGCTGAATGGGCGTATGTGCTTGCTGGAAAAGTACGAGTCACAGCCCTAGACTTA
GAAGGCGGTACTTTTATGGACGACTTGGAGGAAGGAGATCTGTGGTATTTCCCCGCTGGACATCCGCATTCGCTC
CAGGGTCTGGGCGAAAATGGGACAGAATTCCTGTTGATCTTTGACGATGGCAACTTCTCCGAAGAGTCCACCTTC
ATCTTGACTGATTGGTTGGGTATGAATCTGTCCATGTCTCAAAATATATAGTTTACAAATACTGACCCATTTCCC
TAGCTCACACTCCCAAAGCAGTTCTAGGAGAGAACTTCCGGATGTCACCGGAGCAATTTGACAACATCCCGAAAT
CCGAGAAGTACATATTCCAAGGCTCAAACCCGGGAAGCATTGACGAGGAGAAACCACGCACCTTCAAGAAGTCAA
AGATTAACTTCACACATCATATGCTCGCCCAAGAACCCATTAAAACCAGCGGCGGTCGTGTCCGTATTACCGACT
CCACGAACTTCCCGGTTTCCAAAACAGTAGCAGCCGCCCATCTAGAGATTGCACCGGGCGCACTACGCGAGATGC
ACTGGCACCCCAACGCCGACGAATGGACATATTACAAGAAAGGTCGTGCGCGAGTTACGATATTTGCCGCAGAAG
GAAACGCCAGAACGTTCAACTACATGGCCGGTGATGTCGGCATCGTGCCTCGGAATATGGGACACTTCGTTGAGA
ACCTGAGTGACGATGAACCGCTGGAGGTTTTGGAAATTTTCCGGGCAGATCGATTCCAGGATTTCTCACTGTTCC
AATGGCTTGGTAGCTCACCTCGCAGAATGATTGCCGAGAATATATTCCCTGGCGATGCTAAGGCGGCAGAGGAAT
TTTTGAAAAAGATTGAAGATGCTGAAAAGGATCCCATTAAGGATACTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail