Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8749.t1
Gene name
Locationscaffold_20:345054..346830
Strand-
Gene length (bp)1776
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.8E-128 56 514
PF13520 AA_permease_2 Amino acid permease 2.9E-29 59 501

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 86 108 22
3 128 150 22
4 165 187 22
5 194 216 22
6 247 269 22
7 289 308 19
8 337 359 22
9 380 402 22
10 412 434 22
11 454 476 22
12 491 508 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8749.t1
MVSHDASAAHDTKTSANVISVESDNVFRDTKESDAEQNHADTSNSGELKRRLKSRHLQMIAIGGTIGTGLFISSG
TAIAESGPAGALIAYIFVGSIVYSVMSSLGEVATYIPMPGAFTSYAARLIDPSLGFSMGWIYWFNWASTFAVELT
ATGTIIQYWDPSLNIAIFIGVFWVFITAMNFLPVNFYGEVEFWFSTIKVATVVGFIIFAICIDVGVGEQGYLGFR
YWSTPGAFATYSPHLPVSVGKFVGFWAVLIQAGFSYQGTELVGVAAGETENPQKTVPSAIRKTFVRILLFFVLTI
FFIGLVVPYDNGRLTTATTNASSSPMVIAADLAGVKVLPSLINAVLLSVVLSAANSNVYSGSRVLTGLAHEGFAP
ACFGWVTKHGVPYISVTFTALFGLLGFMNVSNDAGQVFTWLVNLSSVAGFVTWASINACHISFMRVLATRGISRD
TLPYKAVLQPYLAWYGLFFNVLIALTQGFTSFIPHFRVTDFFVAYICPIVFVVLYIGHKVIFRPSFVRAADADID
TGRLHYQKQIDPPMPWYWRAWGWFTN*
Coding >Pro_DTO070G2_2|g8749.t1
ATGGTGTCTCACGATGCTTCCGCGGCACATGATACCAAAACATCTGCAAATGTGATCTCTGTAGAGTCGGACAAT
GTTTTTCGAGACACCAAAGAGTCTGATGCCGAGCAAAATCACGCGGACACCTCCAACTCTGGGGAACTCAAGCGC
AGGCTGAAAAGCAGGCATTTACAGATGATTGCAATTGGTGGAACTATTGGCACAGGACTCTTTATTTCCAGTGGT
ACTGCCATCGCAGAATCCGGCCCCGCGGGCGCGTTGATCGCCTATATATTTGTCGGCTCCATTGTCTATTCTGTC
ATGAGCTCGTTGGGCGAAGTTGCAACCTATATTCCAATGCCCGGTGCCTTCACATCCTATGCAGCCCGGTTGATC
GACCCAAGTCTCGGATTTTCCATGGGTTGGATCTATTGGTTCAACTGGGCCTCCACATTTGCTGTCGAACTAACC
GCCACCGGTACTATCATCCAATATTGGGATCCAAGCCTAAACATTGCTATTTTCATCGGAGTGTTTTGGGTGTTC
ATCACGGCTATGAACTTCCTCCCTGTCAATTTCTACGGCGAAGTGGAGTTCTGGTTCTCAACTATCAAAGTGGCC
ACTGTTGTCGGCTTCATCATTTTTGCCATTTGCATCGATGTCGGAGTTGGGGAGCAGGGCTATCTGGGCTTTCGC
TACTGGAGCACGCCAGGGGCTTTTGCCACGTATAGTCCCCATCTACCGGTATCTGTAGGCAAGTTCGTTGGCTTC
TGGGCGGTGCTCATCCAAGCCGGATTCTCTTATCAAGGCACGGAGCTTGTCGGTGTGGCGGCTGGAGAAACCGAA
AACCCACAAAAGACGGTCCCATCAGCTATCCGCAAGACGTTTGTTCGAATTCTTCTCTTCTTTGTCTTGACGATT
TTCTTCATCGGGCTCGTGGTCCCCTATGACAACGGCCGCCTCACCACGGCGACCACCAACGCATCATCCTCGCCT
ATGGTTATTGCAGCTGATTTGGCAGGAGTCAAAGTTCTTCCAAGCTTGATCAATGCTGTGCTCTTGTCCGTGGTC
TTATCGGCCGCAAACTCCAATGTGTATAGCGGCAGTCGAGTCCTCACTGGATTAGCACATGAAGGGTTTGCCCCA
GCCTGTTTCGGTTGGGTAACCAAGCACGGTGTTCCGTATATTAGCGTGACATTCACCGCTTTGTTTGGCTTGTTA
GGTTTCATGAACGTTTCCAATGACGCAGGGCAAGTTTTTACCTGGCTGGTGAATCTTTCTAGTGTTGCGGGCTTT
GTGACTTGGGCCTCCATCAATGCGTGTCATATCTCGTTCATGCGGGTATTGGCAACCCGCGGGATTTCTCGCGAT
ACGCTTCCATATAAGGCCGTCTTGCAACCATATCTCGCTTGGTATGGTTTGTTTTTCAATGTTCTTATCGCCCTC
ACCCAGGGTTTCACTTCTTTCATCCCACATTTCCGGGTGACCGACTTCTTTGTTGCCTACATTTGCCCCATCGTC
TTTGTCGTGCTCTATATTGGACACAAGGTGATTTTCCGTCCGTCATTTGTCCGTGCCGCCGATGCCGATATCGAC
ACTGGCCGCTTGCACTATCAAAAGCAAATCGATCCTCCCATGCCATGGTACTGGAGGGCCTGGGGCTGGTTCACA
AATTAA
Transcript >Pro_DTO070G2_2|g8749.t1
ATGGTGTCTCACGATGCTTCCGCGGCACATGATACCAAAACATCTGCAAATGTGATCTCTGTAGAGTCGGACAAT
GTTTTTCGAGACACCAAAGAGTCTGATGCCGAGCAAAATCACGCGGACACCTCCAACTCTGGGGAACTCAAGCGC
AGGCTGAAAAGCAGGCATTTACAGATGATTGCAATTGGTGGAACTATTGGCACAGGACTCTTTATTTCCAGTGGT
ACTGCCATCGCAGAATCCGGCCCCGCGGGCGCGTTGATCGCCTATATATTTGTCGGCTCCATTGTCTATTCTGTC
ATGAGCTCGTTGGGCGAAGTTGCAACCTATATTCCAATGCCCGGTGCCTTCACATCCTATGCAGCCCGGTTGATC
GACCCAAGTCTCGGATTTTCCATGGGTTGGATCTATTGGTTCAACTGGGCCTCCACATTTGCTGTCGAACTAACC
GCCACCGGTACTATCATCCAATATTGGGATCCAAGCCTAAACATTGCTATTTTCATCGGAGTGTTTTGGGTGTTC
ATCACGGCTATGAACTTCCTCCCTGTCAATTTCTACGGCGAAGTGGAGTTCTGGTTCTCAACTATCAAAGTGGCC
ACTGTTGTCGGCTTCATCATTTTTGCCATTTGCATCGATGTCGGAGTTGGGGAGCAGGGCTATCTGGGCTTTCGC
TACTGGAGCACGCCAGGGGCTTTTGCCACGTATAGTCCCCATCTACCGGTATCTGTAGGCAAGTTCGTTGGCTTC
TGGGCGGTGCTCATCCAAGCCGGATTCTCTTATCAAGGCACGGAGCTTGTCGGTGTGGCGGCTGGAGAAACCGAA
AACCCACAAAAGACGGTCCCATCAGCTATCCGCAAGACGTTTGTTCGAATTCTTCTCTTCTTTGTCTTGACGATT
TTCTTCATCGGGCTCGTGGTCCCCTATGACAACGGCCGCCTCACCACGGCGACCACCAACGCATCATCCTCGCCT
ATGGTTATTGCAGCTGATTTGGCAGGAGTCAAAGTTCTTCCAAGCTTGATCAATGCTGTGCTCTTGTCCGTGGTC
TTATCGGCCGCAAACTCCAATGTGTATAGCGGCAGTCGAGTCCTCACTGGATTAGCACATGAAGGGTTTGCCCCA
GCCTGTTTCGGTTGGGTAACCAAGCACGGTGTTCCGTATATTAGCGTGACATTCACCGCTTTGTTTGGCTTGTTA
GGTTTCATGAACGTTTCCAATGACGCAGGGCAAGTTTTTACCTGGCTGGTGAATCTTTCTAGTGTTGCGGGCTTT
GTGACTTGGGCCTCCATCAATGCGTGTCATATCTCGTTCATGCGGGTATTGGCAACCCGCGGGATTTCTCGCGAT
ACGCTTCCATATAAGGCCGTCTTGCAACCATATCTCGCTTGGTATGGTTTGTTTTTCAATGTTCTTATCGCCCTC
ACCCAGGGTTTCACTTCTTTCATCCCACATTTCCGGGTGACCGACTTCTTTGTTGCCTACATTTGCCCCATCGTC
TTTGTCGTGCTCTATATTGGACACAAGGTGATTTTCCGTCCGTCATTTGTCCGTGCCGCCGATGCCGATATCGAC
ACTGGCCGCTTGCACTATCAAAAGCAAATCGATCCTCCCATGCCATGGTACTGGAGGGCCTGGGGCTGGTTCACA
AATTAA
Gene >Pro_DTO070G2_2|g8749.t1
ATGGTGTCTCACGATGCTTCCGCGGCACATGATACCAAAACATCTGCAAATGTGATCTCTGTAGAGTCGGACAAT
GTTTTTCGAGACACCAAAGAGTCTGATGCCGAGCAAAATCACGCGGACACCTCCAACTCTGGGGAACTCAAGCGC
AGGCTGAAAAGCAGGCATTTACAGATGATTGCAATTGGTAAGTCTTGATTTTCTTGGTCAAGATGGGTTATCGCA
GATGCTAACTGGCTTCGGTCGCAGGTGGAACTATTGGCACAGGTATACTATCTTGCCCTCAGGTCCTCGGCTAGC
AAATCCAGAAGTCTGACCTATCCAGGACTCTTTATTTCCAGTGGTACTGCCATCGCAGAATCCGGCCCCGCGGGC
GCGTTGATCGCCTATATATTTGTCGGCTCCATTGTCTATTCTGTCATGAGCTCGTTGGGCGAAGTTGCAACCTAT
ATTCCAATGCCCGGTGCCTTCACATCCTATGCAGCCCGGTTGATCGACCCAAGTCTCGGATTTTCCATGGGTTGG
ATCTATTGGTTCAACTGGGCCTCCACATTTGCTGTCGAACTAACCGCCACCGGTACTATCATCCAATATTGGGAT
CCAAGCCTAAACATTGCTATTTTCATCGGAGTGTTTTGGGTGTTCATCACGGCTATGAACTTCCTCCCTGTCAAT
TTCTACGGCGAAGTGGAGTTCTGGTTCTCAACTATCAAAGTGGCCACTGTTGTCGGCTTCATCATTTTTGCCATT
TGCATCGATGTCGGAGTTGGGGAGCAGGGCTATCTGGGCTTTCGCTACTGGAGCACGCCAGGGGCTTTTGCCACG
TATAGTCCCCATCTACCGGTATCTGTAGGCAAGTTCGTTGGCTTCTGGGCGGTGCTCATCCAAGCCGGATTCTCT
TATCAAGGCACGGAGCTTGTCGGTGTGGCGGCTGGAGAAACCGAAAACCCACAAAAGACGGTCCCATCAGCTATC
CGCAAGACGTTTGTTCGAATTCTTCTCTTCTTTGTCTTGACGATTTTCTTCATCGGGCTCGTGGTCCCCTATGAC
AACGGCCGCCTCACCACGGCGACCACCAACGCATCATCCTCGCCTATGGTTATTGCAGCTGATTTGGCAGGAGTC
AAAGTTCTTCCAAGCTTGATCAATGCTGTGCTCTTGTCCGTGGTCTTATCGGCCGCAAACTCCAATGTGTATAGC
GGCAGTCGAGTCCTCACTGGATTAGCACATGAAGGGTTTGCCCCAGCCTGTTTCGGTTGGGTAACCAAGCACGGT
GTTCCGTATATTAGCGTGACATTCACCGCTTTGTTTGGCTTGTTAGGTTTCATGAACGTTTCCAATGACGCAGGG
CAAGTTTTTACCTGGCTGGTGAATCTTTCTAGTGTTGCGGGCTTTGTGACTTGGGCCTCCATCAATGCGTGTCAT
ATCTCGTTCATGCGGGTATTGGCAACCCGCGGGATTTCTCGCGATACGCTTCCATATAAGGCCGTCTTGCAACCA
TATCTCGCTTGGTATGGTTTGTTTTTCAATGTTCTTATCGCCCTCACCCAGGGTTTCACTTCTTTCATCCCACAT
TTCCGGGTGACCGACTTCTTTGTTGCCTACATTTGCCCCATCGTCTTTGTCGTGCTCTATATTGGACACAAGGTG
ATTTTCCGTCCGTCATTTGTCCGTGCCGCCGATGCCGATATCGACACTGGCCGCTTGCACTATCAAAAGCAAATC
GATCCTCCCATGCCATGGTACTGGAGGGCCTGGGGCTGGTTCACAAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail