Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8726.t1
Gene name
Locationscaffold_20:274360..274815
Strand-
Gene length (bp)455
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04568 IATP Mitochondrial ATPase inhibitor, IATP 4.3E-20 6 94

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0032780 negative regulation of ATP-dependent activity Yes
GO:0042030 ATPase inhibitor activity Yes
GO:0008150 biological_process No
GO:0044092 negative regulation of molecular function No
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0043462 regulation of ATP-dependent activity No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0098772 molecular function regulator activity No
GO:0005575 cellular_component No
GO:0065009 regulation of molecular function No
GO:0110165 cellular anatomical entity No
GO:0065007 biological regulation No
GO:0043231 intracellular membrane-bounded organelle No
GO:0140678 molecular function inhibitor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8726.t1
MQSAISRPILRVTTNPTLLRSLSITPSIMSAGDTGATKSEFMGQKDSFARREAAHEAMYIRQVEMEKLENLKRKV
EEQRKHMNELDKHIDEYTRSQGGEQN*
Coding >Pro_DTO070G2_2|g8726.t1
ATGCAATCAGCAATTTCCCGACCCATTCTCCGTGTCACTACCAATCCAACTCTTCTCCGATCCCTCTCTATCACC
CCGAGCATCATGAGTGCAGGCGATACCGGTGCTACCAAGTCGGAGTTCATGGGCCAGAAGGACTCTTTCGCCAGA
CGCGAGGCTGCACACGAAGCCATGTACATTCGACAAGTTGAGATGGAGAAACTTGAGAATCTCAAACGAAAGGTC
GAGGAGCAGCGCAAGCATATGAATGAACTTGACAAACATATCGATGAGTATACTAGGTCTCAGGGAGGTGAACAG
AACTAG
Transcript >Pro_DTO070G2_2|g8726.t1
ATGCAATCAGCAATTTCCCGACCCATTCTCCGTGTCACTACCAATCCAACTCTTCTCCGATCCCTCTCTATCACC
CCGAGCATCATGAGTGCAGGCGATACCGGTGCTACCAAGTCGGAGTTCATGGGCCAGAAGGACTCTTTCGCCAGA
CGCGAGGCTGCACACGAAGCCATGTACATTCGACAAGTTGAGATGGAGAAACTTGAGAATCTCAAACGAAAGGTC
GAGGAGCAGCGCAAGCATATGAATGAACTTGACAAACATATCGATGAGTATACTAGGTCTCAGGGAGGTGAACAG
AACTAG
Gene >Pro_DTO070G2_2|g8726.t1
ATGCAATCAGCAATTTCCCGACCCATTCTCCGTGTCACTACCAATCCAACTCTTCTCCGATCCCTCTCTATCACC
CCGAGCATCATGAGTGCAGGCGATACCGGTGCTACCAAGTCGGAGTTCATGGGCCAGTATGGTGGCACAGTGCAA
AATAGATGACGTCATATCTGACTTTTGGCAGGAAGGACTCTTTCGCCAGACGCGAGGCTGCACACGAAGCCATGT
ACATTCGACAAGTTGAGATGGAGAAGTGAGTCACACTGCATCAAGTTCAATACATAAACTTACCTGGTGGTAGAC
TTGAGAATCTCAAACGAAAGGTCGAGGAGCAGCGCAAGCATATGAATGAACTTGACAAACATATGTGGGGATATC
CTGAATTTTCCCACTCGAGACCAACACTGACAGGTCATAGCGATGAGTATACTAGGTCTCAGGGAGGTGAACAGA
ACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail