Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8721.t1
Gene name
Locationscaffold_20:265532..266357
Strand-
Gene length (bp)825
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01674 Lipase_2 Lipase (class 2) 7.3E-07 32 213
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 6.0E-06 33 174

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:1901575 organic substance catabolic process No
GO:0009056 catabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8721.t1
MPSLTKLALSALATTTVVATGINDFSCQSSYNPVVLLHGLGATYYEDLNYMQYWLQTQGFCTYAQTYGAYDGFPL
LGGLKAINESAPEIAAYIKEVVQKTGKSKVDLVGHSEGAFQSLYVPKFEGVAHLVDKIASIAPPTHATTFASIYN
LAYTFGNQSREVVAEVLNTVGCPACNDLGPDGPAINRLNDGTPIAQPGNSVTIIASKYDELVTPPSTSFVHEEGV
TNRWIQDTCPLDPVGHIGEAYDLNVWHLVKNVLTSTDEKFLCLLGSPGK*
Coding >Pro_DTO070G2_2|g8721.t1
ATGCCTTCACTCACGAAGTTGGCGCTCTCTGCCCTCGCGACTACCACAGTCGTCGCAACAGGAATCAACGATTTC
TCCTGCCAAAGCTCATACAACCCAGTTGTCCTCCTGCATGGTCTTGGAGCGACATATTATGAGGATCTGAACTAC
ATGCAGTACTGGCTGCAAACCCAAGGGTTTTGCACATATGCCCAAACCTATGGCGCATACGATGGCTTCCCATTG
CTTGGCGGTTTGAAGGCAATCAACGAGAGCGCTCCCGAAATTGCCGCATACATCAAGGAAGTCGTGCAAAAGACC
GGCAAAAGCAAAGTCGACCTAGTCGGCCACTCCGAGGGTGCTTTCCAATCTCTCTACGTGCCCAAGTTCGAGGGC
GTCGCCCACCTGGTCGACAAGATCGCATCTATCGCACCGCCTACCCATGCCACTACATTTGCCAGCATTTATAAC
CTCGCGTACACATTCGGCAATCAGTCGCGCGAAGTCGTGGCCGAAGTGCTCAATACCGTCGGCTGCCCTGCTTGC
AACGATCTCGGCCCCGATGGCCCAGCCATCAACCGATTGAATGACGGTACCCCTATTGCGCAGCCTGGTAACAGT
GTCACTATCATTGCGTCCAAATACGATGAGCTGGTTACTCCGCCGTCGACATCGTTCGTCCACGAGGAAGGCGTG
ACGAATCGCTGGATCCAGGATACTTGCCCATTGGATCCTGTTGGCCACATTGGCGAGGCCTATGATTTGAATGTC
TGGCACTTGGTCAAGAACGTGCTGACCTCGACGGATGAGAAGTTCTTGTGCCTGCTTGGGTCACCGGGTAAATAA
Transcript >Pro_DTO070G2_2|g8721.t1
ATGCCTTCACTCACGAAGTTGGCGCTCTCTGCCCTCGCGACTACCACAGTCGTCGCAACAGGAATCAACGATTTC
TCCTGCCAAAGCTCATACAACCCAGTTGTCCTCCTGCATGGTCTTGGAGCGACATATTATGAGGATCTGAACTAC
ATGCAGTACTGGCTGCAAACCCAAGGGTTTTGCACATATGCCCAAACCTATGGCGCATACGATGGCTTCCCATTG
CTTGGCGGTTTGAAGGCAATCAACGAGAGCGCTCCCGAAATTGCCGCATACATCAAGGAAGTCGTGCAAAAGACC
GGCAAAAGCAAAGTCGACCTAGTCGGCCACTCCGAGGGTGCTTTCCAATCTCTCTACGTGCCCAAGTTCGAGGGC
GTCGCCCACCTGGTCGACAAGATCGCATCTATCGCACCGCCTACCCATGCCACTACATTTGCCAGCATTTATAAC
CTCGCGTACACATTCGGCAATCAGTCGCGCGAAGTCGTGGCCGAAGTGCTCAATACCGTCGGCTGCCCTGCTTGC
AACGATCTCGGCCCCGATGGCCCAGCCATCAACCGATTGAATGACGGTACCCCTATTGCGCAGCCTGGTAACAGT
GTCACTATCATTGCGTCCAAATACGATGAGCTGGTTACTCCGCCGTCGACATCGTTCGTCCACGAGGAAGGCGTG
ACGAATCGCTGGATCCAGGATACTTGCCCATTGGATCCTGTTGGCCACATTGGCGAGGCCTATGATTTGAATGTC
TGGCACTTGGTCAAGAACGTGCTGACCTCGACGGATGAGAAGTTCTTGTGCCTGCTTGGGTCACCGGGTAAATAA
Gene >Pro_DTO070G2_2|g8721.t1
ATGCCTTCACTCACGAAGTTGGCGCTCTCTGCCCTCGCGACTACCACAGTCGTCGCAACAGGAATCAACGATTTC
TCCTGCCAAAGCTCATACAACCCAGTTGTCCTCCTGCATGGTCTTGGAGCGACATATTATGAGGATCTGAACTAC
ATGCAGTACTGGCTGCAAACCCAAGGGTTTTGCACATATGCCCAAACCTATGGCGCATACGATGGCTTCCCATTG
CTTGGCGGTTTGAAGGCAATCAACGAGAGCGCTCCCGAAATTGCCGCATACATCAAGGAAGTCGTGCAAAAGACC
GGCAAAAGCAAAGTCGACCTAGTCGGCCACTCCGAGGGTGCTTTCCAATCTCTCTACGTGCCCAAGTTCGAGGGC
GTCGCCCACCTGGTCGACAAGATCGCATCTATCGCACCGCCTACCCATGCCACTACATTTGCCAGCATTTATAAC
CTCGCGTACACATTCGGCAATCAGTCGCGCGAAGTCGTGGCCGAAGTGCTCAATACCGTCGGCTGCCCTGCTTGC
AACGATCTCGGCCCCGATGGCCCAGCCATCAACCGATTGAATGACGGTACCCCTATTGCGCAGCCTGGTAACAGT
GTCACTATCATTGCGTCCAAATACGATGAGCTGGTTACTCCGCCGTCGACATCGTTCGTCCACGAGGAAGGCGTG
ACGAATCGCTGGATCCAGGATACTTGCCCATTGGATCCTGTTGGCCACATTGGCGAGGCCTATGATTTGAATGTC
TGGCACTTGGTCAAGAACGTGCTGACCTCGACGGATGAGAAGTTCTTGTGCCTGCTTGGGTCACCGGGTAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail