Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g860.t1
Gene name
Locationscaffold_01:2315075..2322649
Strand-
Gene length (bp)7574
Transcript length (bp)7272
Coding sequence length (bp)7272
Protein length (aa) 2424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 6.7E-66 876 1157
PF08659 KR KR domain 2.5E-58 2039 2216
PF00698 Acyl_transf_1 Acyl transferase domain 2.8E-57 505 828
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 6.4E-30 14 177
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.8E-14 178 240
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 8.1E-30 249 364
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.6E-24 368 482
PF08242 Methyltransf_12 Methyltransferase domain 3.8E-17 1327 1431
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 8.5E-15 1836 1942
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.0E-12 1877 2011
PF13489 Methyltransf_23 Methyltransferase domain 3.3E-11 1311 1482
PF13649 Methyltransf_25 Methyltransferase domain 3.8E-09 1326 1429
PF00106 adh_short short chain dehydrogenase 5.0E-08 2042 2198
PF08241 Methyltransf_11 Methyltransferase domain 2.4E-07 1327 1432
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 4.9E-07 1717 1777
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-06 1322 1437
PF00550 PP-binding Phosphopantetheine attachment site 6.6E-05 2354 2401

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g860.t1
MILKVVEPKPVPPEPIAICGMSVRLPGGLHTPQQLWDFLVAKGDARGQVPKSRYNVSTYYSETQKPGSVKTEYGY
FLDESIDIASVDTSFFTMGKLEVERMDPQQRQMLEVARECMEDAGETNWKGRPIGCYMGSFGEDWLEICVKETQQ
YGQHRVSGYGDFMLPNRVSYEMDLTGPRGDCESAIVGGANLIMAPGMTAAMSEQGVISPDGSCKSFSADANGYAR
GEGISAIFIKPLADALRDGNPVRAVIRSTSSNSDGRGAGIGAHVPNDVSHEAMIRRAYEVAGITDYSQTAFFECH
GTGTQVGDPIETRAVGRVFGPSGGILIGSVKPNLGHAEGASGITSLIKSVLALENRTIPPNIKFKERNPNIQWDE
YGLAVPTDPMPWPEARSERISVNSFGIGGTNAHVIVDSARSFGVSPVATRHTISPQLLVYSANNAESLKQMISHY
TSYVQKNPARVADLAFTLANKREHLPHRAFSVQSPLGPLTTSAPSKTGETPNIVMVFTGQGAQWPQMGASMIHND
VYPAFKKSIQNLDSHLQTLTDAPDWSIEEELLKDPDTSRLSSSELSQPLCTAIQVALIDTFASVGVQPAAVVGHS
SGEIAAAYAAGAITATEAITIAFYRGQVTKAQTRPGSMAAIGMGAEDIQEYLQDGVVVACENSPKSVTLAGDTHA
IEKVVAIIKEAHPDVLARQLKVDKAYHSHHMAEIGDEYHALIEHEISTKAPNKLFFSSVENELLTEAQHLGPKYW
QMNLQSPVLFRSAVSSIIKHQISKNMVLLEVGPHSALAGPLRQIQSHLSTSSPYISTFVRNQDSTESFLTAIGQL
HVLNAVPALDKVISTGSTLPDLPRYPWDHSKKFWYESRLSKEWRHREHKYHDLLGVRVTESPDFHPLFRNLFHLD
NAPWIRDHKVGDDIVFPFAGYAAMIGEAVRQVTGVREAFKLRNVIVSTALVLNEGPPVEIMTTLHRHRLTDSLDS
EWWEFAITSHNGANWIKHCSGEVRSLNEYLEDVDKKAPLVRKVETRRCYHSMAMSGLNFGPSFQRLDHVRSDTVS
QSATSELVAKDTDGDNYHLHPTVIDASLQLLSVAASKGYAEPITNIMVPTHIQEISIYRCYENVHVQASASYTPN
GSIIGSGQCITAGGKVALRSSGIKLSVLDHQDPEKGEPPIGCAEWAPHIDFLDVNTLIKPLIDRSDYMPALTELS
HLCMIYTQRVIADLDTPISHMYKYRSWIDQHLLSVDLQSLQILDNIAIKQRVKELVDQISQTNGAHLAVGIEVIF
NNVQQIFTGEAEALDLLLTDDILANVYNAMDQCDISEFIRNLTHTKPNLRILEIGAGTGGSTANILKLLTPGSRT
LYMNYTFTDISSGFFVAAKDRFASYPNIEYATLDISKDPSDQGFDDRKYDLILATNVIHATASLNDSLSNIHKLL
SPTGWLLLHELTPISKWINYIFGTLAGWWYGEVDGRSGEPYIGIERWAKELKAAGFRTPDAAVLDSNQPHQLNAM
IVARPEVDIAPKKCVTVLTLSKSMSVGPLLQALDNRGYSVHHSRFDEEPLPEGQDVIALLDEEAPFFEGMDNQRF
DSFKKLAHSLDQRGVLWVTRSSQAQCRDPRFAQINGVARTIRNELRVDFATCEVDDLDVSFEKLIDVYEKFQVRQ
EDETLKPEFEYAIVDNTVQVGRYHPFSAQNGQEALASNSSIALRTSKPGRLASLHWAHGDIKPLEGDEVEIDTYA
IGLNFKDVLCAMGIVEAKENEFGHEGAGIVRRTGPDVQSLKVGDRVMVVGSCLFGTQLVLSENLCEKIPGGLSFS
DAASMPCVFSTSIYSIFDVGNLKKGQSILIHSACGGVGIATIQLAQMVGAEIYATVGNEEKVRYLMDTFGLPRNR
ILNSRNASFVEDIMRETNGQGVDLALNSLSGELLHATWKCIAPFGKMVEIGKRDLIGSGKLDMTPFLDNRSYCCV
DLDQICSRKPILAKKLLKEIVDLLKERYISPIRPIKVFSSDGIHDAFRYMQQGTHLGKIVVSMRDTSGQVSAVQN
IQPRKKPTQLNSSGAYLLVGGLGGLGRAISTWMVQRGARHLIYLSRTAGSSESHREFAQELASMDCRVDFVQGSV
SNIADVTTAVTRAQGRLRGILQMSMMLRDRSFERMTLEEWNTSVDPKVKGTWNLHNASVSANAELDFFVLFSSVS
GVFGLPGQINYAGANTFLDAFSQYRLGLGLPACAIDIGIVEGVGYAAEQDEILQKLKAAGGLGNTVSVSELLSAV
EAAMTSISSNLRPQAGNFGVGIRPNVPLADQRNRLVWKKDIRMSVFHNTGAAGTILTSASDAGAGLEAFITQAKG
DAALINQPGSAQMLAVEIGKKVFSFLLKPEEDLVTSCSLSDLGMDSLVAIEVKQWWKATFGFDISVLELMGMGSL
DILGEHAAHGMLRLFHGVQDQAD*
Coding >Pro_DTO070G2_2|g860.t1
ATGATTCTCAAGGTTGTTGAACCGAAACCGGTTCCCCCAGAGCCAATCGCTATATGTGGAATGTCTGTACGTCTC
CCTGGAGGCCTACACACACCCCAACAGCTATGGGACTTCCTGGTTGCCAAAGGAGATGCCCGTGGCCAAGTGCCG
AAGTCCAGATATAATGTCTCCACATACTACTCCGAGACCCAGAAACCGGGCAGCGTCAAGACCGAGTATGGATAC
TTCCTGGATGAAAGCATTGACATTGCTTCTGTGGATACATCCTTCTTCACAATGGGCAAGTTGGAGGTGGAGCGC
ATGGATCCACAGCAACGGCAGATGCTGGAAGTTGCCAGGGAGTGTATGGAAGATGCCGGCGAAACCAACTGGAAA
GGACGACCGATTGGGTGCTACATGGGTAGCTTTGGTGAAGACTGGCTTGAAATCTGTGTCAAAGAAACCCAACAA
TACGGCCAGCATCGAGTGAGCGGATATGGAGACTTCATGCTGCCTAACCGAGTCTCATATGAGATGGACCTGACG
GGGCCGAGGGGCGATTGCGAGAGCGCTATAGTTGGCGGTGCGAATTTGATAATGGCACCAGGCATGACAGCTGCC
ATGAGTGAGCAAGGCGTAATTTCACCGGATGGGTCTTGCAAGAGCTTCTCTGCCGATGCCAATGGTTATGCGCGA
GGAGAGGGAATCTCTGCTATCTTCATCAAGCCCCTGGCTGATGCCCTCCGGGATGGAAATCCAGTTCGAGCGGTT
ATCCGTTCGACATCATCCAACAGTGACGGAAGGGGTGCTGGAATCGGCGCACATGTTCCCAACGATGTTTCGCAC
GAGGCCATGATCAGGCGTGCATATGAGGTGGCAGGTATTACAGATTACTCCCAGACCGCATTTTTCGAGTGTCAT
GGTACTGGCACCCAAGTTGGAGATCCCATCGAAACCCGAGCAGTGGGTCGGGTTTTTGGTCCTTCTGGTGGTATC
CTCATTGGGTCTGTCAAACCCAATCTTGGTCACGCTGAAGGAGCTTCGGGAATTACATCCCTGATCAAGTCGGTA
CTAGCCCTGGAAAATCGGACCATTCCTCCAAATATCAAGTTTAAGGAGCGCAACCCCAACATCCAGTGGGATGAA
TATGGGCTCGCTGTTCCCACAGACCCGATGCCATGGCCTGAGGCCAGGAGCGAGCGAATTAGTGTGAACTCTTTT
GGAATTGGAGGTACCAACGCTCACGTTATTGTCGATTCAGCTCGGAGCTTTGGTGTCTCCCCCGTTGCCACACGG
CATACCATTTCGCCCCAGCTGCTTGTTTATTCCGCAAACAATGCCGAGTCACTAAAACAAATGATTTCCCACTAC
ACATCCTATGTTCAGAAGAACCCAGCCAGAGTTGCCGATCTGGCGTTCACTCTAGCTAATAAAAGGGAGCATCTG
CCTCATCGGGCATTCTCTGTGCAAAGCCCATTGGGTCCGCTCACGACTTCGGCACCCTCGAAAACTGGGGAGACA
CCAAATATCGTCATGGTTTTCACGGGCCAGGGCGCTCAGTGGCCACAAATGGGTGCCTCTATGATCCACAACGAC
GTCTATCCCGCATTTAAGAAGAGCATTCAAAATCTTGACTCACATTTGCAAACCCTCACAGATGCTCCAGACTGG
AGCATTGAAGAAGAGCTCTTGAAGGACCCCGATACCAGCAGACTCAGCTCGTCTGAATTATCCCAGCCTCTCTGT
ACAGCAATCCAGGTGGCTCTGATCGATACTTTTGCTTCCGTTGGAGTTCAACCTGCTGCTGTCGTGGGTCATTCC
AGCGGCGAAATAGCTGCTGCATACGCTGCCGGTGCTATCACAGCCACCGAAGCAATCACGATTGCATTCTATCGA
GGTCAGGTCACCAAGGCGCAAACCAGGCCTGGGTCCATGGCAGCTATAGGCATGGGAGCTGAGGACATCCAGGAA
TATCTACAGGACGGTGTCGTTGTTGCTTGCGAAAACTCACCTAAGAGTGTTACCCTCGCTGGTGATACACATGCT
ATTGAAAAGGTAGTTGCCATCATTAAGGAGGCCCATCCTGATGTCCTGGCTAGACAGTTGAAAGTCGACAAGGCG
TACCACTCTCATCATATGGCTGAGATAGGTGACGAGTACCATGCTTTGATTGAACATGAAATATCCACCAAGGCT
CCAAATAAGTTATTCTTCAGCAGTGTCGAGAACGAACTACTCACGGAAGCCCAACATCTCGGCCCTAAATACTGG
CAGATGAACCTTCAGTCTCCGGTCCTCTTCCGCTCGGCTGTATCGTCTATAATTAAGCACCAGATTTCGAAGAAT
ATGGTGCTGCTTGAAGTTGGACCGCACTCCGCTCTTGCGGGCCCCTTGCGACAGATCCAGAGTCATCTTTCCACT
TCTTCTCCTTATATTTCTACGTTTGTTCGCAACCAGGATAGTACGGAATCTTTCCTGACTGCCATTGGCCAACTG
CATGTTCTCAATGCTGTCCCAGCGTTGGATAAGGTCATCAGCACGGGCTCTACTCTCCCAGATCTTCCAAGATAC
CCATGGGATCACTCAAAGAAATTCTGGTATGAGTCTCGGTTGAGCAAGGAGTGGAGGCATCGCGAGCACAAATAT
CACGATCTTTTGGGTGTCCGGGTAACAGAGAGTCCTGACTTCCATCCTCTGTTCCGAAATCTCTTTCACTTGGAC
AACGCCCCGTGGATTCGCGACCACAAGGTTGGTGATGATATTGTATTCCCCTTCGCTGGCTATGCTGCGATGATT
GGCGAGGCTGTGAGACAGGTTACCGGAGTTCGCGAGGCATTCAAACTGCGCAACGTCATTGTCAGCACTGCCCTT
GTCTTGAATGAGGGCCCACCAGTTGAGATCATGACAACATTACATCGCCATAGATTGACTGATTCCCTGGACAGT
GAGTGGTGGGAATTTGCCATCACTTCTCACAACGGAGCGAATTGGATCAAGCATTGCTCAGGCGAGGTCAGATCG
CTTAACGAATACCTTGAAGATGTAGACAAGAAAGCCCCTCTTGTGCGCAAGGTTGAAACACGCCGTTGCTATCAT
TCTATGGCCATGTCTGGTCTGAATTTTGGGCCATCATTTCAACGTCTTGACCATGTCCGCTCAGACACTGTTTCG
CAGAGCGCGACGTCTGAACTTGTTGCGAAAGATACTGATGGGGATAACTATCATTTGCACCCCACAGTCATCGAT
GCCTCACTTCAGCTGCTCAGTGTCGCTGCTTCCAAAGGATATGCCGAACCGATAACCAACATAATGGTTCCTACT
CACATTCAAGAGATCTCCATCTACCGCTGTTATGAGAATGTCCACGTCCAAGCTTCCGCATCTTACACCCCGAAC
GGCTCTATCATTGGGAGTGGCCAGTGTATTACTGCAGGGGGGAAAGTTGCTTTACGCAGTTCTGGAATTAAACTC
TCTGTTCTCGATCATCAGGACCCTGAAAAGGGGGAACCCCCCATTGGCTGTGCAGAATGGGCTCCCCATATCGAC
TTCCTGGATGTCAACACTCTCATCAAGCCATTGATTGACCGCAGTGATTACATGCCCGCTTTGACAGAGCTATCT
CATCTGTGTATGATTTACACACAGCGTGTGATTGCGGATCTGGATACTCCAATCAGCCACATGTACAAGTATCGA
TCATGGATTGATCAACACCTGTTGTCTGTGGATCTGCAAAGTCTCCAAATCCTTGACAATATTGCCATTAAACAG
CGAGTGAAAGAACTCGTTGACCAAATTTCCCAAACTAATGGCGCCCATCTTGCTGTTGGTATTGAAGTGATTTTC
AATAACGTCCAACAGATTTTCACCGGGGAGGCTGAGGCTCTGGATCTCCTTCTGACCGATGACATATTGGCCAAC
GTCTACAACGCTATGGATCAGTGTGATATTTCCGAATTCATCAGGAACTTAACTCACACTAAGCCTAATCTGCGT
ATCCTCGAAATAGGTGCCGGAACCGGTGGGTCTACAGCTAATATCCTGAAGCTGTTGACCCCTGGGAGTAGGACC
CTATACATGAACTACACCTTCACGGATATCTCATCTGGCTTCTTTGTTGCTGCAAAGGATCGATTTGCCAGTTAC
CCAAACATCGAATACGCTACTCTCGACATTAGTAAGGATCCCTCCGATCAGGGGTTCGATGATCGCAAATACGAC
CTAATTCTGGCGACCAATGTCATCCACGCCACAGCATCCTTGAACGACAGTTTAAGCAACATTCATAAACTTCTT
TCTCCGACCGGATGGCTCCTGCTCCACGAATTGACACCCATATCCAAATGGATCAACTATATCTTTGGAACCCTG
GCCGGTTGGTGGTACGGCGAGGTTGATGGCCGGTCGGGCGAGCCGTACATAGGCATTGAACGCTGGGCAAAGGAA
CTCAAGGCCGCTGGATTTCGCACTCCTGATGCTGCAGTTCTGGATTCGAACCAACCACATCAGTTGAACGCCATG
ATCGTGGCGAGACCGGAGGTTGACATCGCACCTAAGAAATGCGTCACTGTCTTGACCCTCTCTAAATCAATGTCC
GTAGGTCCTTTGCTTCAGGCTCTGGATAACAGGGGATACTCCGTTCATCATTCTCGGTTTGACGAAGAGCCCCTG
CCTGAAGGACAAGATGTGATTGCCTTGCTTGATGAAGAAGCCCCATTCTTCGAAGGCATGGATAACCAACGCTTT
GACTCTTTCAAGAAATTGGCACACAGCCTAGATCAACGTGGTGTTCTGTGGGTGACTCGTTCATCACAAGCCCAA
TGTCGGGACCCGAGATTTGCCCAGATCAACGGCGTAGCGAGGACGATTCGCAATGAATTGCGTGTCGACTTTGCT
ACTTGCGAGGTTGACGATCTTGATGTCTCTTTTGAGAAACTCATCGACGTATATGAGAAGTTCCAAGTCCGCCAG
GAGGATGAGACCCTCAAGCCTGAATTTGAATACGCTATCGTGGACAATACGGTACAAGTTGGGCGGTATCATCCT
TTCTCGGCGCAAAATGGACAAGAGGCGCTGGCTTCAAATAGTAGCATCGCCCTTCGAACAAGTAAACCAGGCCGC
TTGGCTTCGTTACACTGGGCTCATGGGGATATCAAACCTCTGGAGGGAGATGAGGTGGAAATCGACACTTACGCA
ATCGGTTTGAATTTCAAGGATGTCTTATGTGCCATGGGTATTGTCGAAGCCAAAGAAAATGAATTTGGCCATGAA
GGCGCGGGCATAGTCCGCCGCACTGGCCCCGATGTTCAAAGTCTGAAAGTCGGTGATCGTGTCATGGTCGTCGGG
AGCTGTTTATTTGGGACGCAATTAGTTCTCTCCGAGAACCTGTGCGAGAAGATTCCAGGCGGCTTAAGCTTCAGT
GATGCGGCCAGCATGCCTTGCGTGTTCAGTACATCGATATACTCCATCTTTGACGTTGGAAATCTGAAAAAAGGA
CAGTCCATTCTTATCCATAGTGCCTGTGGTGGAGTTGGCATTGCGACCATTCAGCTTGCTCAAATGGTTGGTGCC
GAGATTTACGCAACTGTCGGTAACGAGGAGAAGGTCAGGTATCTCATGGACACGTTTGGCCTTCCTCGGAACAGG
ATCCTAAACTCCCGTAATGCCTCGTTTGTTGAGGATATCATGCGGGAGACAAATGGACAGGGTGTCGACTTGGCA
TTGAACTCATTGTCTGGTGAACTATTGCATGCTACGTGGAAATGCATTGCACCTTTTGGGAAGATGGTCGAGATT
GGCAAGCGAGACTTGATTGGCTCTGGAAAACTTGATATGACTCCTTTCTTGGACAACCGGAGCTATTGCTGTGTC
GACTTGGATCAAATTTGTTCCAGAAAGCCGATCCTTGCAAAGAAGCTGCTGAAGGAAATTGTGGACCTACTCAAG
GAGCGCTACATCTCTCCTATCCGACCTATCAAAGTCTTTAGTTCTGATGGAATACACGACGCTTTCCGTTACATG
CAGCAAGGCACTCATCTAGGAAAGATCGTTGTCTCGATGCGTGATACTTCAGGCCAGGTCAGCGCTGTACAAAAC
ATCCAGCCACGAAAAAAGCCCACCCAACTCAACAGCTCCGGTGCATACCTGCTCGTAGGTGGCCTCGGAGGCCTG
GGTCGGGCTATATCTACGTGGATGGTTCAACGTGGAGCTCGCCACCTCATATATCTTTCCCGAACTGCGGGTTCG
AGCGAAAGCCACCGCGAGTTTGCCCAAGAGCTTGCCAGTATGGATTGTCGTGTGGACTTTGTTCAAGGTAGCGTG
TCCAATATCGCGGATGTGACCACCGCTGTCACACGGGCTCAAGGCCGACTTCGGGGCATCTTGCAGATGTCCATG
ATGCTTCGTGATCGGAGCTTTGAACGCATGACACTAGAAGAGTGGAACACATCTGTTGATCCGAAGGTCAAGGGA
ACGTGGAACCTTCACAATGCTTCTGTATCTGCCAATGCGGAACTTGACTTCTTTGTTCTTTTCAGTTCGGTGTCT
GGTGTCTTTGGACTCCCTGGTCAGATCAACTATGCTGGTGCCAACACGTTCCTGGATGCATTTTCTCAATACCGA
TTGGGGTTGGGACTACCTGCTTGCGCGATCGATATCGGTATTGTCGAAGGAGTCGGTTATGCTGCCGAGCAGGAT
GAAATCTTACAAAAGCTCAAAGCCGCTGGTGGTCTAGGCAATACGGTCTCAGTGAGCGAGCTTCTGAGCGCGGTA
GAGGCAGCGATGACATCTATCTCAAGTAATTTGAGACCCCAAGCAGGCAACTTCGGCGTTGGAATTCGGCCCAAC
GTGCCTCTGGCCGATCAAAGAAACCGTTTGGTCTGGAAGAAGGACATACGAATGTCGGTGTTCCATAATACTGGA
GCAGCTGGTACCATCTTGACTTCTGCTTCTGACGCTGGTGCTGGCTTGGAGGCTTTTATTACACAGGCCAAGGGC
GACGCTGCGCTAATAAATCAACCTGGATCTGCTCAAATGCTCGCCGTGGAAATTGGAAAGAAGGTGTTTAGCTTC
TTGCTGAAGCCTGAAGAAGATCTGGTGACATCTTGCTCCTTGTCTGATCTTGGAATGGACTCTCTCGTGGCAATT
GAGGTGAAACAGTGGTGGAAGGCGACATTTGGGTTCGATATCAGTGTCCTGGAATTGATGGGAATGGGCTCTCTC
GATATACTCGGAGAGCACGCTGCTCATGGCATGCTTAGATTGTTCCATGGTGTACAAGATCAAGCTGATTGA
Transcript >Pro_DTO070G2_2|g860.t1
ATGATTCTCAAGGTTGTTGAACCGAAACCGGTTCCCCCAGAGCCAATCGCTATATGTGGAATGTCTGTACGTCTC
CCTGGAGGCCTACACACACCCCAACAGCTATGGGACTTCCTGGTTGCCAAAGGAGATGCCCGTGGCCAAGTGCCG
AAGTCCAGATATAATGTCTCCACATACTACTCCGAGACCCAGAAACCGGGCAGCGTCAAGACCGAGTATGGATAC
TTCCTGGATGAAAGCATTGACATTGCTTCTGTGGATACATCCTTCTTCACAATGGGCAAGTTGGAGGTGGAGCGC
ATGGATCCACAGCAACGGCAGATGCTGGAAGTTGCCAGGGAGTGTATGGAAGATGCCGGCGAAACCAACTGGAAA
GGACGACCGATTGGGTGCTACATGGGTAGCTTTGGTGAAGACTGGCTTGAAATCTGTGTCAAAGAAACCCAACAA
TACGGCCAGCATCGAGTGAGCGGATATGGAGACTTCATGCTGCCTAACCGAGTCTCATATGAGATGGACCTGACG
GGGCCGAGGGGCGATTGCGAGAGCGCTATAGTTGGCGGTGCGAATTTGATAATGGCACCAGGCATGACAGCTGCC
ATGAGTGAGCAAGGCGTAATTTCACCGGATGGGTCTTGCAAGAGCTTCTCTGCCGATGCCAATGGTTATGCGCGA
GGAGAGGGAATCTCTGCTATCTTCATCAAGCCCCTGGCTGATGCCCTCCGGGATGGAAATCCAGTTCGAGCGGTT
ATCCGTTCGACATCATCCAACAGTGACGGAAGGGGTGCTGGAATCGGCGCACATGTTCCCAACGATGTTTCGCAC
GAGGCCATGATCAGGCGTGCATATGAGGTGGCAGGTATTACAGATTACTCCCAGACCGCATTTTTCGAGTGTCAT
GGTACTGGCACCCAAGTTGGAGATCCCATCGAAACCCGAGCAGTGGGTCGGGTTTTTGGTCCTTCTGGTGGTATC
CTCATTGGGTCTGTCAAACCCAATCTTGGTCACGCTGAAGGAGCTTCGGGAATTACATCCCTGATCAAGTCGGTA
CTAGCCCTGGAAAATCGGACCATTCCTCCAAATATCAAGTTTAAGGAGCGCAACCCCAACATCCAGTGGGATGAA
TATGGGCTCGCTGTTCCCACAGACCCGATGCCATGGCCTGAGGCCAGGAGCGAGCGAATTAGTGTGAACTCTTTT
GGAATTGGAGGTACCAACGCTCACGTTATTGTCGATTCAGCTCGGAGCTTTGGTGTCTCCCCCGTTGCCACACGG
CATACCATTTCGCCCCAGCTGCTTGTTTATTCCGCAAACAATGCCGAGTCACTAAAACAAATGATTTCCCACTAC
ACATCCTATGTTCAGAAGAACCCAGCCAGAGTTGCCGATCTGGCGTTCACTCTAGCTAATAAAAGGGAGCATCTG
CCTCATCGGGCATTCTCTGTGCAAAGCCCATTGGGTCCGCTCACGACTTCGGCACCCTCGAAAACTGGGGAGACA
CCAAATATCGTCATGGTTTTCACGGGCCAGGGCGCTCAGTGGCCACAAATGGGTGCCTCTATGATCCACAACGAC
GTCTATCCCGCATTTAAGAAGAGCATTCAAAATCTTGACTCACATTTGCAAACCCTCACAGATGCTCCAGACTGG
AGCATTGAAGAAGAGCTCTTGAAGGACCCCGATACCAGCAGACTCAGCTCGTCTGAATTATCCCAGCCTCTCTGT
ACAGCAATCCAGGTGGCTCTGATCGATACTTTTGCTTCCGTTGGAGTTCAACCTGCTGCTGTCGTGGGTCATTCC
AGCGGCGAAATAGCTGCTGCATACGCTGCCGGTGCTATCACAGCCACCGAAGCAATCACGATTGCATTCTATCGA
GGTCAGGTCACCAAGGCGCAAACCAGGCCTGGGTCCATGGCAGCTATAGGCATGGGAGCTGAGGACATCCAGGAA
TATCTACAGGACGGTGTCGTTGTTGCTTGCGAAAACTCACCTAAGAGTGTTACCCTCGCTGGTGATACACATGCT
ATTGAAAAGGTAGTTGCCATCATTAAGGAGGCCCATCCTGATGTCCTGGCTAGACAGTTGAAAGTCGACAAGGCG
TACCACTCTCATCATATGGCTGAGATAGGTGACGAGTACCATGCTTTGATTGAACATGAAATATCCACCAAGGCT
CCAAATAAGTTATTCTTCAGCAGTGTCGAGAACGAACTACTCACGGAAGCCCAACATCTCGGCCCTAAATACTGG
CAGATGAACCTTCAGTCTCCGGTCCTCTTCCGCTCGGCTGTATCGTCTATAATTAAGCACCAGATTTCGAAGAAT
ATGGTGCTGCTTGAAGTTGGACCGCACTCCGCTCTTGCGGGCCCCTTGCGACAGATCCAGAGTCATCTTTCCACT
TCTTCTCCTTATATTTCTACGTTTGTTCGCAACCAGGATAGTACGGAATCTTTCCTGACTGCCATTGGCCAACTG
CATGTTCTCAATGCTGTCCCAGCGTTGGATAAGGTCATCAGCACGGGCTCTACTCTCCCAGATCTTCCAAGATAC
CCATGGGATCACTCAAAGAAATTCTGGTATGAGTCTCGGTTGAGCAAGGAGTGGAGGCATCGCGAGCACAAATAT
CACGATCTTTTGGGTGTCCGGGTAACAGAGAGTCCTGACTTCCATCCTCTGTTCCGAAATCTCTTTCACTTGGAC
AACGCCCCGTGGATTCGCGACCACAAGGTTGGTGATGATATTGTATTCCCCTTCGCTGGCTATGCTGCGATGATT
GGCGAGGCTGTGAGACAGGTTACCGGAGTTCGCGAGGCATTCAAACTGCGCAACGTCATTGTCAGCACTGCCCTT
GTCTTGAATGAGGGCCCACCAGTTGAGATCATGACAACATTACATCGCCATAGATTGACTGATTCCCTGGACAGT
GAGTGGTGGGAATTTGCCATCACTTCTCACAACGGAGCGAATTGGATCAAGCATTGCTCAGGCGAGGTCAGATCG
CTTAACGAATACCTTGAAGATGTAGACAAGAAAGCCCCTCTTGTGCGCAAGGTTGAAACACGCCGTTGCTATCAT
TCTATGGCCATGTCTGGTCTGAATTTTGGGCCATCATTTCAACGTCTTGACCATGTCCGCTCAGACACTGTTTCG
CAGAGCGCGACGTCTGAACTTGTTGCGAAAGATACTGATGGGGATAACTATCATTTGCACCCCACAGTCATCGAT
GCCTCACTTCAGCTGCTCAGTGTCGCTGCTTCCAAAGGATATGCCGAACCGATAACCAACATAATGGTTCCTACT
CACATTCAAGAGATCTCCATCTACCGCTGTTATGAGAATGTCCACGTCCAAGCTTCCGCATCTTACACCCCGAAC
GGCTCTATCATTGGGAGTGGCCAGTGTATTACTGCAGGGGGGAAAGTTGCTTTACGCAGTTCTGGAATTAAACTC
TCTGTTCTCGATCATCAGGACCCTGAAAAGGGGGAACCCCCCATTGGCTGTGCAGAATGGGCTCCCCATATCGAC
TTCCTGGATGTCAACACTCTCATCAAGCCATTGATTGACCGCAGTGATTACATGCCCGCTTTGACAGAGCTATCT
CATCTGTGTATGATTTACACACAGCGTGTGATTGCGGATCTGGATACTCCAATCAGCCACATGTACAAGTATCGA
TCATGGATTGATCAACACCTGTTGTCTGTGGATCTGCAAAGTCTCCAAATCCTTGACAATATTGCCATTAAACAG
CGAGTGAAAGAACTCGTTGACCAAATTTCCCAAACTAATGGCGCCCATCTTGCTGTTGGTATTGAAGTGATTTTC
AATAACGTCCAACAGATTTTCACCGGGGAGGCTGAGGCTCTGGATCTCCTTCTGACCGATGACATATTGGCCAAC
GTCTACAACGCTATGGATCAGTGTGATATTTCCGAATTCATCAGGAACTTAACTCACACTAAGCCTAATCTGCGT
ATCCTCGAAATAGGTGCCGGAACCGGTGGGTCTACAGCTAATATCCTGAAGCTGTTGACCCCTGGGAGTAGGACC
CTATACATGAACTACACCTTCACGGATATCTCATCTGGCTTCTTTGTTGCTGCAAAGGATCGATTTGCCAGTTAC
CCAAACATCGAATACGCTACTCTCGACATTAGTAAGGATCCCTCCGATCAGGGGTTCGATGATCGCAAATACGAC
CTAATTCTGGCGACCAATGTCATCCACGCCACAGCATCCTTGAACGACAGTTTAAGCAACATTCATAAACTTCTT
TCTCCGACCGGATGGCTCCTGCTCCACGAATTGACACCCATATCCAAATGGATCAACTATATCTTTGGAACCCTG
GCCGGTTGGTGGTACGGCGAGGTTGATGGCCGGTCGGGCGAGCCGTACATAGGCATTGAACGCTGGGCAAAGGAA
CTCAAGGCCGCTGGATTTCGCACTCCTGATGCTGCAGTTCTGGATTCGAACCAACCACATCAGTTGAACGCCATG
ATCGTGGCGAGACCGGAGGTTGACATCGCACCTAAGAAATGCGTCACTGTCTTGACCCTCTCTAAATCAATGTCC
GTAGGTCCTTTGCTTCAGGCTCTGGATAACAGGGGATACTCCGTTCATCATTCTCGGTTTGACGAAGAGCCCCTG
CCTGAAGGACAAGATGTGATTGCCTTGCTTGATGAAGAAGCCCCATTCTTCGAAGGCATGGATAACCAACGCTTT
GACTCTTTCAAGAAATTGGCACACAGCCTAGATCAACGTGGTGTTCTGTGGGTGACTCGTTCATCACAAGCCCAA
TGTCGGGACCCGAGATTTGCCCAGATCAACGGCGTAGCGAGGACGATTCGCAATGAATTGCGTGTCGACTTTGCT
ACTTGCGAGGTTGACGATCTTGATGTCTCTTTTGAGAAACTCATCGACGTATATGAGAAGTTCCAAGTCCGCCAG
GAGGATGAGACCCTCAAGCCTGAATTTGAATACGCTATCGTGGACAATACGGTACAAGTTGGGCGGTATCATCCT
TTCTCGGCGCAAAATGGACAAGAGGCGCTGGCTTCAAATAGTAGCATCGCCCTTCGAACAAGTAAACCAGGCCGC
TTGGCTTCGTTACACTGGGCTCATGGGGATATCAAACCTCTGGAGGGAGATGAGGTGGAAATCGACACTTACGCA
ATCGGTTTGAATTTCAAGGATGTCTTATGTGCCATGGGTATTGTCGAAGCCAAAGAAAATGAATTTGGCCATGAA
GGCGCGGGCATAGTCCGCCGCACTGGCCCCGATGTTCAAAGTCTGAAAGTCGGTGATCGTGTCATGGTCGTCGGG
AGCTGTTTATTTGGGACGCAATTAGTTCTCTCCGAGAACCTGTGCGAGAAGATTCCAGGCGGCTTAAGCTTCAGT
GATGCGGCCAGCATGCCTTGCGTGTTCAGTACATCGATATACTCCATCTTTGACGTTGGAAATCTGAAAAAAGGA
CAGTCCATTCTTATCCATAGTGCCTGTGGTGGAGTTGGCATTGCGACCATTCAGCTTGCTCAAATGGTTGGTGCC
GAGATTTACGCAACTGTCGGTAACGAGGAGAAGGTCAGGTATCTCATGGACACGTTTGGCCTTCCTCGGAACAGG
ATCCTAAACTCCCGTAATGCCTCGTTTGTTGAGGATATCATGCGGGAGACAAATGGACAGGGTGTCGACTTGGCA
TTGAACTCATTGTCTGGTGAACTATTGCATGCTACGTGGAAATGCATTGCACCTTTTGGGAAGATGGTCGAGATT
GGCAAGCGAGACTTGATTGGCTCTGGAAAACTTGATATGACTCCTTTCTTGGACAACCGGAGCTATTGCTGTGTC
GACTTGGATCAAATTTGTTCCAGAAAGCCGATCCTTGCAAAGAAGCTGCTGAAGGAAATTGTGGACCTACTCAAG
GAGCGCTACATCTCTCCTATCCGACCTATCAAAGTCTTTAGTTCTGATGGAATACACGACGCTTTCCGTTACATG
CAGCAAGGCACTCATCTAGGAAAGATCGTTGTCTCGATGCGTGATACTTCAGGCCAGGTCAGCGCTGTACAAAAC
ATCCAGCCACGAAAAAAGCCCACCCAACTCAACAGCTCCGGTGCATACCTGCTCGTAGGTGGCCTCGGAGGCCTG
GGTCGGGCTATATCTACGTGGATGGTTCAACGTGGAGCTCGCCACCTCATATATCTTTCCCGAACTGCGGGTTCG
AGCGAAAGCCACCGCGAGTTTGCCCAAGAGCTTGCCAGTATGGATTGTCGTGTGGACTTTGTTCAAGGTAGCGTG
TCCAATATCGCGGATGTGACCACCGCTGTCACACGGGCTCAAGGCCGACTTCGGGGCATCTTGCAGATGTCCATG
ATGCTTCGTGATCGGAGCTTTGAACGCATGACACTAGAAGAGTGGAACACATCTGTTGATCCGAAGGTCAAGGGA
ACGTGGAACCTTCACAATGCTTCTGTATCTGCCAATGCGGAACTTGACTTCTTTGTTCTTTTCAGTTCGGTGTCT
GGTGTCTTTGGACTCCCTGGTCAGATCAACTATGCTGGTGCCAACACGTTCCTGGATGCATTTTCTCAATACCGA
TTGGGGTTGGGACTACCTGCTTGCGCGATCGATATCGGTATTGTCGAAGGAGTCGGTTATGCTGCCGAGCAGGAT
GAAATCTTACAAAAGCTCAAAGCCGCTGGTGGTCTAGGCAATACGGTCTCAGTGAGCGAGCTTCTGAGCGCGGTA
GAGGCAGCGATGACATCTATCTCAAGTAATTTGAGACCCCAAGCAGGCAACTTCGGCGTTGGAATTCGGCCCAAC
GTGCCTCTGGCCGATCAAAGAAACCGTTTGGTCTGGAAGAAGGACATACGAATGTCGGTGTTCCATAATACTGGA
GCAGCTGGTACCATCTTGACTTCTGCTTCTGACGCTGGTGCTGGCTTGGAGGCTTTTATTACACAGGCCAAGGGC
GACGCTGCGCTAATAAATCAACCTGGATCTGCTCAAATGCTCGCCGTGGAAATTGGAAAGAAGGTGTTTAGCTTC
TTGCTGAAGCCTGAAGAAGATCTGGTGACATCTTGCTCCTTGTCTGATCTTGGAATGGACTCTCTCGTGGCAATT
GAGGTGAAACAGTGGTGGAAGGCGACATTTGGGTTCGATATCAGTGTCCTGGAATTGATGGGAATGGGCTCTCTC
GATATACTCGGAGAGCACGCTGCTCATGGCATGCTTAGATTGTTCCATGGTGTACAAGATCAAGCTGATTGA
Gene >Pro_DTO070G2_2|g860.t1
ATGATTCTCAAGGTTGTTGAACCGAAACCGGTTCCCCCAGAGCCAATCGCTATATGTGGAATGTCTGTACGTCTC
CCTGGAGGCCTACACACACCCCAACAGCTATGGGACTTCCTGGTTGCCAAAGGAGATGCCCGTGGCCAAGTGCCG
AAGTCCAGATATAATGTCTCCACATACTACTCCGAGACCCAGAAACCGGGCAGCGTCAAGACCGAGTATGGATAC
TTCCTGGATGAAAGCATTGACATTGCTTCTGTGGATACATCCTTCTTCACAATGGGCAAGTTGGAGGTGGAGCGC
ATGGATCCACAGCAACGGCAGATGCTGGAAGTTGCCAGGGAGTGTATGGAAGATGCCGGCGAAACCAACTGGAAA
GGACGACCGATTGGGTGCTACATGGGTAGCTTTGGTGAAGACTGGCTTGAAATCTGTGTCAAAGAAACCCAACAA
TACGGCCAGCATCGAGTGAGCGGATATGGAGACTTCATGCTGCCTAACCGAGTCTCATATGAGATGGACCTGACG
GGGCCGAGGTTAGTTGTTCCATATTTTTTTTTATCTTGGAATAGAATGCAATTGCTAAGTGGAAAAAAATAATAA
AGCATGGTCGTACGTACTGGCTGCTCAGCAGGTATTGTTGCACTGCATGAAGCATGTCTGGCAATTTCCAGGGGC
GATTGCGAGAGCGCTATAGTTGGCGGTGCGAATTTGATAATGGCACCAGGCATGACAGCTGCCATGAGTGAGCAA
GGCGTAATTTCACCGGATGGGTCTTGCAAGAGCTTCTCTGCCGATGCCAATGGTTATGCGCGAGGAGAGGGAATC
TCTGCTATCTTCATCAAGCCCCTGGCTGATGCCCTCCGGGATGGAAATCCAGTTCGAGCGGTTATCCGTTCGACA
TCATCCAACAGTGACGGAAGGGGTGCTGGAATCGGCGCACATGTTCCCAACGATGTTTCGCACGAGGCCATGATC
AGGCGTGCATATGAGGTGGCAGGTATTACAGATTACTCCCAGACCGCATTTTTCGAGTGTCATGGTACTGGCACC
CAAGTTGGAGATCCCATCGAAACCCGAGCAGTGGGTCGGGTTTTTGGTCCTTCTGGTGGTATCCTCATTGGGTCT
GTCAAACCCAATCTTGGTCACGCTGAAGGAGCTTCGGGAATTACATCCCTGATCAAGTCGGTACTAGCCCTGGAA
AATCGGACCATTCCTCCAAATATCAAGTTTAAGGAGCGCAACCCCAACATCCAGTGGGATGAATATGGGCTCGCT
GTTCCCACAGACCCGATGCCATGGCCTGAGGCCAGGAGCGAGCGAATTAGTGTGAACTCTTTTGGAATTGGAGGT
ACCAACGCTCACGTTATTGTCGATTCAGCTCGGAGCTTTGGTGTCTCCCCCGTTGCCACACGGCATACCATTTCG
CCCCAGCTGCTTGTTTATTCCGCAAACAATGCCGAGTCACTAAAACAAATGATTTCCCACTACACATCCTATGTT
CAGAAGAACCCAGCCAGAGTTGCCGATCTGGCGTTCACTCTAGCTAATAAAAGGGAGCATCTGCCTCATCGGGCA
TTCTCTGTGCAAAGCCCATTGGGTCCGCTCACGACTTCGGCACCCTCGAAAACTGGGGAGACACCAAATATCGTC
ATGGTTTTCACGGGCCAGGGCGCTCAGTGGCCACAAATGGGTGCCTCTATGATCCACAACGACGTCTATCCCGCA
TTTAAGAAGAGCATTCAAAATCTTGACTCACATTTGCAAACCCTCACAGATGCTCCAGACTGGAGCATTGAAGAA
GAGCTCTTGAAGGACCCCGATACCAGCAGACTCAGCTCGTCTGAATTATCCCAGCCTCTCTGTACAGCAATCCAG
GTGGCTCTGATCGATACTTTTGCTTCCGTTGGAGTTCAACCTGCTGCTGTCGTGGGTCATTCCAGCGGCGAAATA
GCTGCTGCATACGCTGCCGGTGCTATCACAGCCACCGAAGCAATCACGATTGCATTCTATCGAGGTCAGGTCACC
AAGGCGCAAACCAGGCCTGGGTCCATGGCAGCTATAGGCATGGGAGCTGAGGACATCCAGGAATATCTACAGGAC
GGTGTCGTTGTTGCTTGCGAAAACTCACCTAAGAGTGTTACCCTCGCTGGTGATACACATGCTATTGAAAAGGTA
GTTGCCATCATTAAGGAGGCCCATCCTGATGTCCTGGCTAGACAGTTGAAAGTCGACAAGGCGTACCACTCTCAT
CATATGGCTGAGATAGGTGACGAGTACCATGCTTTGATTGAACATGAAATATCCACCAAGGCTCCAAATAAGTTA
TTCTTCAGCAGTGTCGAGAACGAACTACTCACGGAAGCCCAACATCTCGGCCCTAAATACTGGCAGATGAACCTT
CAGTCTCCGGTCCTCTTCCGCTCGGCTGTATCGTCTATAATTAAGCACCAGATTTCGAAGAATATGGTGCTGCTT
GAAGTTGGACCGCACTCCGCTCTTGCGGGCCCCTTGCGACAGATCCAGAGTCATCTTTCCACTTCTTCTCCTTAT
ATTTCTACGTTTGTTCGCAACCAGGATAGTACGGAATCTTTCCTGACTGCCATTGGCCAACTGCATGTTCTCAAT
GCTGTCCCAGCGTTGGATAAGGTCATCAGCACGGGCTCTACTCTCCCAGATCTTCCAAGATACCCATGGGATCAC
TCAAAGAAATTCTGGTATGAGTCTCGGTTGAGCAAGGAGTGGAGGCATCGCGAGCACAAATATCACGATCTTTTG
GGTGTCCGGGTAACAGAGAGTCCTGACTTCCATCCTCTGTTCCGAAATCTCTTTCACTTGGACAACGCCCCGTGG
ATTCGCGACCACAAGGTTGGTGATGATATTGTATTCCCCTTCGCTGGCTATGCTGCGATGATTGGCGAGGCTGTG
AGACAGGTTACCGGAGTTCGCGAGGCATTCAAACTGCGCAACGTCATTGTCAGCACTGCCCTTGTCTTGAATGAG
GGCCCACCAGTTGAGATCATGACAACATTACATCGCCATAGATTGACTGATTCCCTGGACAGTGAGTGGTGGGAA
TTTGCCATCACTTCTCACAACGGAGCGAATTGGATCAAGCATTGCTCAGGCGAGGTCAGATCGCTTAACGAATAC
CTTGAAGATGTAGACAAGAAAGCCCCTCTTGTGCGCAAGGTTGAAACACGCCGTTGCTATCATTCTATGGCCATG
TCTGGTCTGAATTTTGGGCCATCATTTCAACGTCTTGACCATGTCCGCTCAGACACTGTTTCGCAGAGCGCGACG
TCTGAACTTGTTGCGAAAGATACTGATGGGGATAACTATCATTTGCACCCCACAGTCATCGATGCCTCACTTCAG
CTGCTCAGTGTCGCTGCTTCCAAAGGATATGCCGAACCGATAACCAACATAATGGTTCCTACTCACATTCAAGAG
ATCTCCATCTACCGCTGTTATGAGAATGTCCACGTCCAAGCTTCCGCATCTTACACCCCGAACGGCTCTATCATT
GGGAGTGGCCAGTGTATTACTGCAGGGGGGAAAGTTGCTTTACGCAGTTCTGGAATTAAACTCTCTGTTCTCGAT
CATCAGGACCCTGAAAAGGGGGAACCCCCCATTGGCTGTGCAGAATGGGCTCCCCATATCGACTTCCTGGATGTC
AACACTCTCATCAAGCCATTGATTGACCGCAGTGATTACATGCCCGCTTTGACAGAGCTATCTCATCTGTGTATG
ATTTACACACAGCGTGTGATTGCGGATCTGGATACTCCAATCAGCCACATGTACAAGTATCGATCATGGATTGAT
CAACACCTGTTGTCTGTGGATCTGCAAAGTCTCCAAATCCTTGACAATATTGCCATTAAACAGCGAGTGAAAGAA
CTCGTTGACCAAATTTCCCAAACTAATGGCGCCCATCTTGCTGTTGGTATTGAAGTGATTTTCAATAACGTCCAA
CAGATTTTCACCGGGGAGGCTGAGGCTCTGGATCTCCTTCTGACCGATGACATATTGGCCAACGTCTACAACGCT
ATGGATCAGTGTGATATTTCCGAATTCATCAGGAACTTAACTCACACTAAGCCTAATCTGCGTATCCTCGAAATA
GGTGCCGGAACCGGTGGGTCTACAGCTAATATCCTGAAGCTGTTGACCCCTGGGAGTAGGACCCTATACATGAAC
TACACCTTCACGGATATCTCATCTGGCTTCTTTGTTGCTGCAAAGGATCGATTTGCCAGTTACCCAAACATCGAA
TACGCTACTCTCGACATTAGTAAGGATCCCTCCGATCAGGGGTTCGATGATCGCAAATACGACCTAATTCTGGCG
ACCAATGTCATCCACGCCACAGCATCCTTGAACGACAGTTTAAGCAACATTCATAAACTTCTTTCTCCGACCGGA
TGGCTCCTGCTCCACGAATTGACACCCATATCCAAATGGATCAACTATATCTTTGGAACCCTGGCCGGTTGGTGG
TACGGCGAGGTTGATGGCCGGTCGGGCGAGCCGTACATAGGCATTGAACGCTGGGCAAAGGAACTCAAGGCCGCT
GGATTTCGCACTCCTGATGCTGCAGTTCTGGATTCGAACCAACCACATCAGTTGAACGCCATGATCGTGGCGAGA
CCGGAGGTTGACATCGCACCTAAGAAATGCGTCACTGTCTTGACCCTCTCTAAATCAATGTCCGTAGGTCCTTTG
CTTCAGGCTCTGGATAACAGGGGATACTCCGTTCATCATTCTCGGTTTGACGAAGAGCCCCTGCCTGAAGGACAA
GATGTGATTGCCTTGCTTGATGAAGAAGCCCCATTCTTCGAAGGCATGGATAACCAACGCTTTGACTCTTTCAAG
AAATTGGCACACAGCCTAGATCAACGTGGTGTTCTGTGGGTGACTCGTTCATCACAAGCCCAATGTCGGGACCCG
AGATTTGCCCAGATCAACGGCGTAGCGAGGACGATTCGCAATGAATTGCGTGTCGACTTTGCTACTTGCGAGGTT
GACGATCTTGATGTCTCTTTTGAGAAACTCATCGACGTATATGAGAAGTTCCAAGTCCGCCAGGAGGATGAGACC
CTCAAGCCTGAATTTGAATACGCTATCGTGGACAATACGGTACAAGTTGGGCGGTATCATCCTTTCTCGGCGCAA
AATGGACAAGAGGCGCTGGCTTCAAATAGTAGCATCGCCCTTCGAACAAGTAAACCAGGCCGCTTGGCTTCGTTA
CACTGGGCTCATGGGGATATCAAACCTCTGGAGGGAGATGAGGTGGAAATCGACACTTACGCAATCGGTTTGAAT
TTCAAGGTAAGTTCGAAGGTAACAAGTGGACCTAATAACACATACTGATATGAAACAGGATGTCTTATGTGCCAT
GGGTATTGTCGAAGCCAAAGAAAATGAATTTGGCCATGAAGGCGCGGGCATAGTCCGCCGCACTGGCCCCGATGT
TCAAAGTCTGAAAGTCGGTGATCGTGTCATGGTCGTCGGGAGCTGTTTATTTGGGACGCAATTAGTTCTCTCCGA
GAACCTGTGCGAGAAGATTCCAGGCGGCTTAAGCTTCAGTGATGCGGCCAGCATGCCTTGCGTGTTCAGTACATC
GATATACTCCATCTTTGACGTTGGAAATCTGAAAAAAGGACAGGTTTGTTCCCCCTCAACCTTTTGACGTTTTAG
GTCATCTTTTGACATATTTTATAGTCCATTCTTATCCATAGTGCCTGTGGTGGAGTTGGCATTGCGACCATTCAG
CTTGCTCAAATGGTTGGTGCCGAGATTTACGCAACTGTCGGTAACGAGGAGAAGGTCAGGTATCTCATGGACACG
TTTGGCCTTCCTCGGAACAGGATCCTAAACTCCCGTAATGCCTCGTTTGTTGAGGATATCATGCGGGAGACAAAT
GGACAGGGTGTCGACTTGGCATTGAACTCATTGTCTGGTGAACTATTGCATGCTACGTGGAAATGCATTGCACCT
TTTGGGAAGATGGTCGAGATTGGCAAGCGAGACTTGATTGGCTCTGGAAAACTTGATATGACTCCTTTCTTGGAC
AACCGGAGCTATTGCTGTGTCGACTTGGATCAAATTTGTTCCAGAAAGCCGATCCTTGCAAAGAAGTATGTATCG
AAGGGGATGACAATGTATGAGACTCGACAACTGACATATTATGCAGGCTGCTGAAGGAAATTGTGGACCTACTCA
AGGAGCGCTACATCTCTCCTATCCGACCTATCAAAGTCTTTAGTTCTGATGGAATACACGACGCTTTCCGTTACA
TGCAGCAAGGCACTCATCTAGGAAAGATCGTTGTCTCGATGCGTGATACTTCAGGCCAGGTCAGCGCTGTACAAA
ACATCCAGCCACGAAAAAAGCCCACCCAACTCAACAGCTCCGGTGCATACCTGCTCGTAGGTGGCCTCGGAGGCC
TGGGTCGGGCTATATCTACGTGGATGGTTCAACGTGGAGCTCGCCACCTCATATATCTTTCCCGAACTGCGGGTT
CGAGCGAAAGCCACCGCGAGTTTGCCCAAGAGCTTGCCAGTATGGATTGTCGTGTGGACTTTGTTCAAGGTAGCG
TGTCCAATATCGCGGATGTGACCACCGCTGTCACACGGGCTCAAGGCCGACTTCGGGGCATCTTGCAGATGTCCA
TGATGCTTCGTGATCGGAGCTTTGAACGCATGACACTAGAAGAGTGGAACACATCTGTTGATCCGAAGGTCAAGG
GAACGTGGAACCTTCACAATGCTTCTGTATCTGCCAATGCGGAACTTGACTTCTTTGTTCTTTTCAGTTCGGTGT
CTGGTGTCTTTGGACTCCCTGGTCAGATCAACTATGCTGGTGCCAACACGTTCCTGGATGCATTTTCTCAATACC
GATTGGGGTTGGGACTACCTGCTTGCGCGATCGATATCGGTATTGTCGAAGGAGTCGGTTATGCTGCCGAGCAGG
ATGAAATCTTACAAAAGCTCAAAGCCGCTGGTGGTCTAGGCAATACGGTCTCAGTGAGCGAGCTTCTGAGCGCGG
TAGAGGCAGCGATGACATCTATCTCAAGTAATTTGAGACCCCAAGCAGGCAACTTCGGCGTTGGAATTCGGCCCA
ACGTGCCTCTGGCCGATCAAAGAAACCGTTTGGTCTGGAAGAAGGACATACGAATGTCGGTGTTCCATAATACTG
GAGCAGCTGGTACCATCTTGACTTCTGCTTCTGACGCTGGTGCTGGCTTGGAGGCTTTTATTACACAGGCCAAGG
GCGACGCTGCGCTAATAAATCAACCTGGATCTGCTCAAATGCTCGCCGTGGAAATTGGAAAGAAGGTGTTTAGCT
TCTTGCTGAAGCCTGAAGAAGATCTGGTGACATCTTGCTCCTTGTCTGATCTTGGAATGGACTCTCTCGTGGCAA
TTGAGGTGAAACAGTGGTGGAAGGCGACATTTGGGTTCGATATCAGTGTCCTGGAATTGATGGGAATGGGCTCTC
TCGATATACTCGGAGAGCACGCTGCTCATGGCATGCTTAGATTGTTCCATGGTGTACAAGATCAAGCTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail