Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8576.t1
Gene name
Locationscaffold_19:298785..301268
Strand-
Gene length (bp)2483
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 2.6E-15 159 208
PF01846 FF FF domain 2.0E-11 226 276
PF01846 FF FF domain 2.4E-12 373 427
PF00397 WW WW domain 5.5E-08 12 37
PF00397 WW WW domain 8.6E-08 52 78

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8576.t1
MDPSRNPNSALWQQAQNAEGRVYYYNIQTKATQWTKPQELMTPVELALANQPWKEHTTDAGRKYWYHSETKQSTW
EMPEVYKNALAQAPAPQATPAAPSFVAGGASFSQLQQRDREDFDRGERGYNDRRGGYGSFETNSMVAAPEYKSQM
DPDYHTLEEAESAFMKLLKRHNVQPDWTWDATMRATIKDPQYRALKDPRDRKAAFEKYVVQVRMQEKERAKERFA
KLRADFNTMLKRHPEIKYYSRWKTIRPIIEGETTFRSTNEEDERRQLFDEYILELKKAHAEQEFVTHKAAMDELM
TIMDSLNLEPYTRWSEAHAIIQSDSKFQTDDKFKSLTKSDILIAFENHIKSLERAFNDARQQHKAARTRKERKNR
EQFVALLKELKSQGKIKAGTKWMNICPIIKDDPRYHGILGQPGSTPLDLFWDMVEEEERALRGPRNDVLDVLDDK
RFEVTTETTFDEFNSIMSADRRTSKIDPEILNLIFQRIQDKAVRRTEDEKHAADRQQRRAVDALRSRIKRLEPPV
RVTDTWAEVQPRLEKYDEYKAIESDEIRESAFEKAIRRLKERDEDAEREREVHSQSRGSRRDYDRGDREYRSGRG
ERRGPSGQTNRTPEMDAYEADRRKAQADRERTYRKVSGISPSRDRRDERGDRYRSRDRDFDRPRARDPDRREDER
ERLYRTRGDPRGSRDELDYGGGTGAVDTRSVASGDRRRRRDSDTESVASRKRYRRESRERSKGPRVPRQERSAIP
EEEIEDAKKDEKAIHSGSEEGEIEEE*
Coding >Pro_DTO070G2_2|g8576.t1
ATGGATCCAAGCCGCAACCCAAATTCTGCCCTGTGGCAGCAGGCGCAAAATGCGGAAGGACGCGTTTATTATTAC
AATATCCAGACCAAAGCCACACAATGGACCAAGCCGCAAGAGTTGATGACTCCGGTTGAGCTTGCTCTCGCGAAT
CAACCATGGAAGGAGCACACTACGGATGCTGGGCGCAAATACTGGTATCACTCAGAAACTAAGCAGAGCACATGG
GAGATGCCTGAAGTTTACAAAAACGCGCTCGCACAGGCGCCTGCCCCCCAGGCGACCCCCGCTGCCCCTTCATTT
GTCGCCGGCGGAGCCTCTTTCTCGCAACTGCAGCAACGTGACCGTGAAGACTTCGACCGAGGTGAGCGGGGATAC
AACGACCGACGCGGTGGATACGGCTCGTTTGAAACGAACAGCATGGTCGCTGCTCCAGAATACAAGTCCCAGATG
GACCCCGACTATCATACTCTCGAGGAGGCGGAGAGCGCCTTCATGAAGCTGCTCAAGCGCCACAACGTGCAGCCT
GATTGGACTTGGGACGCGACAATGCGCGCTACGATCAAGGACCCGCAGTACCGGGCTCTTAAGGATCCGCGAGAC
CGCAAGGCAGCCTTCGAGAAATACGTGGTCCAGGTTCGCATGCAGGAAAAGGAGCGGGCGAAAGAACGATTCGCC
AAGCTTCGCGCGGACTTCAACACTATGCTGAAGCGCCATCCTGAAATAAAATACTACAGCCGCTGGAAGACGATT
CGACCGATCATTGAGGGGGAGACTACCTTCAGGTCTACCAATGAGGAAGACGAGAGACGCCAGCTTTTCGACGAG
TACATCCTCGAACTCAAGAAGGCTCACGCCGAGCAAGAATTTGTCACGCACAAGGCTGCCATGGATGAGTTGATG
ACCATTATGGATTCACTCAACCTGGAGCCATACACGCGTTGGTCCGAGGCTCATGCCATCATTCAGTCTGACAGC
AAGTTCCAAACCGATGACAAGTTCAAATCCCTGACCAAGTCTGACATTTTGATTGCCTTCGAAAATCATATCAAG
TCCCTGGAGCGGGCTTTCAACGATGCTCGCCAGCAACACAAGGCAGCCAGAACCAGAAAGGAGCGTAAGAACCGA
GAGCAATTCGTGGCCCTCCTTAAGGAGCTCAAATCCCAGGGTAAGATCAAGGCGGGCACCAAGTGGATGAATATC
TGCCCGATCATTAAGGATGACCCCAGATATCATGGCATCCTAGGCCAGCCTGGTTCGACCCCTCTTGATTTGTTC
TGGGATATGGTGGAGGAAGAAGAACGCGCTTTGCGAGGACCTCGGAACGACGTGCTCGATGTTCTGGATGACAAG
CGATTTGAAGTTACGACTGAAACCACGTTTGACGAATTCAATTCTATCATGTCCGCCGACCGTCGCACCTCCAAG
ATTGACCCTGAGATTCTCAATCTCATTTTCCAGCGCATCCAAGACAAGGCAGTTCGACGTACGGAGGATGAAAAG
CATGCAGCCGATCGTCAACAGCGTCGCGCCGTGGACGCACTGCGTTCTCGTATCAAGCGCCTAGAGCCGCCTGTC
CGGGTCACCGACACCTGGGCTGAAGTCCAACCTCGCCTTGAGAAATACGACGAATACAAGGCCATTGAGTCCGAT
GAAATTCGGGAGTCTGCCTTTGAAAAAGCAATTCGCCGCTTGAAAGAAAGAGATGAGGATGCAGAGAGGGAGCGT
GAGGTACACTCTCAAAGCCGTGGAAGCCGACGGGATTATGACCGCGGTGATCGTGAATATCGCAGTGGGCGAGGA
GAACGACGAGGACCCAGCGGCCAGACCAACCGGACCCCGGAAATGGATGCATACGAAGCAGACCGTCGCAAGGCA
CAGGCCGACCGCGAACGAACTTACCGCAAGGTCAGCGGTATCTCCCCATCTCGTGATCGTCGCGATGAGCGTGGA
GACCGTTATCGTAGCCGGGACCGTGACTTTGACCGTCCCCGCGCTAGAGACCCAGACCGACGTGAAGACGAACGC
GAGCGCCTTTACCGCACTCGTGGAGATCCCCGTGGAAGTCGTGATGAGCTTGATTATGGTGGTGGTACTGGTGCT
GTTGACACTCGCAGTGTGGCCAGTGGTGACCGCCGACGCCGACGTGACAGTGATACCGAGAGTGTGGCTAGCCGT
AAGCGGTACCGACGTGAGAGCCGTGAGCGCAGCAAGGGTCCGAGAGTCCCCCGACAGGAACGGTCCGCTATTCCG
GAAGAAGAGATCGAGGATGCGAAGAAAGATGAGAAGGCCATTCACTCTGGCAGCGAGGAAGGAGAGATTGAAGAG
GAGTAG
Transcript >Pro_DTO070G2_2|g8576.t1
ATGGATCCAAGCCGCAACCCAAATTCTGCCCTGTGGCAGCAGGCGCAAAATGCGGAAGGACGCGTTTATTATTAC
AATATCCAGACCAAAGCCACACAATGGACCAAGCCGCAAGAGTTGATGACTCCGGTTGAGCTTGCTCTCGCGAAT
CAACCATGGAAGGAGCACACTACGGATGCTGGGCGCAAATACTGGTATCACTCAGAAACTAAGCAGAGCACATGG
GAGATGCCTGAAGTTTACAAAAACGCGCTCGCACAGGCGCCTGCCCCCCAGGCGACCCCCGCTGCCCCTTCATTT
GTCGCCGGCGGAGCCTCTTTCTCGCAACTGCAGCAACGTGACCGTGAAGACTTCGACCGAGGTGAGCGGGGATAC
AACGACCGACGCGGTGGATACGGCTCGTTTGAAACGAACAGCATGGTCGCTGCTCCAGAATACAAGTCCCAGATG
GACCCCGACTATCATACTCTCGAGGAGGCGGAGAGCGCCTTCATGAAGCTGCTCAAGCGCCACAACGTGCAGCCT
GATTGGACTTGGGACGCGACAATGCGCGCTACGATCAAGGACCCGCAGTACCGGGCTCTTAAGGATCCGCGAGAC
CGCAAGGCAGCCTTCGAGAAATACGTGGTCCAGGTTCGCATGCAGGAAAAGGAGCGGGCGAAAGAACGATTCGCC
AAGCTTCGCGCGGACTTCAACACTATGCTGAAGCGCCATCCTGAAATAAAATACTACAGCCGCTGGAAGACGATT
CGACCGATCATTGAGGGGGAGACTACCTTCAGGTCTACCAATGAGGAAGACGAGAGACGCCAGCTTTTCGACGAG
TACATCCTCGAACTCAAGAAGGCTCACGCCGAGCAAGAATTTGTCACGCACAAGGCTGCCATGGATGAGTTGATG
ACCATTATGGATTCACTCAACCTGGAGCCATACACGCGTTGGTCCGAGGCTCATGCCATCATTCAGTCTGACAGC
AAGTTCCAAACCGATGACAAGTTCAAATCCCTGACCAAGTCTGACATTTTGATTGCCTTCGAAAATCATATCAAG
TCCCTGGAGCGGGCTTTCAACGATGCTCGCCAGCAACACAAGGCAGCCAGAACCAGAAAGGAGCGTAAGAACCGA
GAGCAATTCGTGGCCCTCCTTAAGGAGCTCAAATCCCAGGGTAAGATCAAGGCGGGCACCAAGTGGATGAATATC
TGCCCGATCATTAAGGATGACCCCAGATATCATGGCATCCTAGGCCAGCCTGGTTCGACCCCTCTTGATTTGTTC
TGGGATATGGTGGAGGAAGAAGAACGCGCTTTGCGAGGACCTCGGAACGACGTGCTCGATGTTCTGGATGACAAG
CGATTTGAAGTTACGACTGAAACCACGTTTGACGAATTCAATTCTATCATGTCCGCCGACCGTCGCACCTCCAAG
ATTGACCCTGAGATTCTCAATCTCATTTTCCAGCGCATCCAAGACAAGGCAGTTCGACGTACGGAGGATGAAAAG
CATGCAGCCGATCGTCAACAGCGTCGCGCCGTGGACGCACTGCGTTCTCGTATCAAGCGCCTAGAGCCGCCTGTC
CGGGTCACCGACACCTGGGCTGAAGTCCAACCTCGCCTTGAGAAATACGACGAATACAAGGCCATTGAGTCCGAT
GAAATTCGGGAGTCTGCCTTTGAAAAAGCAATTCGCCGCTTGAAAGAAAGAGATGAGGATGCAGAGAGGGAGCGT
GAGGTACACTCTCAAAGCCGTGGAAGCCGACGGGATTATGACCGCGGTGATCGTGAATATCGCAGTGGGCGAGGA
GAACGACGAGGACCCAGCGGCCAGACCAACCGGACCCCGGAAATGGATGCATACGAAGCAGACCGTCGCAAGGCA
CAGGCCGACCGCGAACGAACTTACCGCAAGGTCAGCGGTATCTCCCCATCTCGTGATCGTCGCGATGAGCGTGGA
GACCGTTATCGTAGCCGGGACCGTGACTTTGACCGTCCCCGCGCTAGAGACCCAGACCGACGTGAAGACGAACGC
GAGCGCCTTTACCGCACTCGTGGAGATCCCCGTGGAAGTCGTGATGAGCTTGATTATGGTGGTGGTACTGGTGCT
GTTGACACTCGCAGTGTGGCCAGTGGTGACCGCCGACGCCGACGTGACAGTGATACCGAGAGTGTGGCTAGCCGT
AAGCGGTACCGACGTGAGAGCCGTGAGCGCAGCAAGGGTCCGAGAGTCCCCCGACAGGAACGGTCCGCTATTCCG
GAAGAAGAGATCGAGGATGCGAAGAAAGATGAGAAGGCCATTCACTCTGGCAGCGAGGAAGGAGAGATTGAAGAG
GAGTAG
Gene >Pro_DTO070G2_2|g8576.t1
ATGGATCCAAGCCGCAACCCAAATTCTGCCCTGTGGCAGCAGGCGCAAAATGCGGAAGGACGCGTTTATTATTAC
AATATCCAGACCAAAGCCACACAATGGACCAAGCCGCAAGAGTTGATGACTCCGGTTGAGGTGCGTACCTGACCG
CAAAATGTTACGCGCTTAACTGACTTCTTTATAGCTTGCTCTCGCGAATCAACCATGGAAGGAGCACACTACGGA
TGCTGGGCGCAAATACTGGTATCACTCAGAAACTAAGCAGAGCACATGGGAGATGCCTGAAGTTTACAAAAACGC
GCTCGCACAGGCGCCTGCCCCCCAGGCGACCCCCGCGTAAGTGCTTCCCCAACTTAACTTCCCTCAATGCTAATT
CCTTCACAGTGCCCCTTCATTTGTCGCCGGCGGAGCCTCTTTCTCGCAACTGCAGCAACGTGACCGTGAAGACTT
CGACCGAGGTGAGCGGGGATACAACGACCGACGCGGTGGATACGGCTCGTTTGAAACGAACAGCATGGTCGCTGC
TCCAGAATACAAGTCCCAGATGGACCCCGACTATCATACTCTCGAGGAGGCGGAGAGCGCCTTCATGAAGCTGCT
CAAGCGCCACAACGTGCAGCCTGATTGGACTTGGGACGCGACAATGCGCGCTACGATCAAGGACCCGCAGTACCG
GGCTCTTAAGGATCCGCGAGACCGCAAGGCAGCCTTCGAGAAATACGTGGTCCAGGTTCGCATGCAGGAAAAGGA
GCGGGCGAAAGAACGATTCGCCAAGCTTCGCGCGGACTTCAACACTATGCTGAAGCGCCATCCTGAAATAAAATA
CTACAGCCGCTGGAAGACGATTCGACCGATCATTGAGGGGGAGACTACCTTCAGGTCTACCAATGAGGAAGACGA
GAGACGCCAGCTTTTCGACGAGTACATCCTCGAACTCAAGAAGGCTCACGCCGAGCAAGAATTTGTCACGCACAA
GGCTGCCATGGATGAGTTGATGACCATTATGGATTCACTCAACCTGGAGCCATACACGCGTTGGTCCGAGGCTCA
TGCCATCATTCAGTCTGACAGCAAGTTCCAAACCGATGACAAGTTCAAATCCCTGACCAAGTCTGACATTTTGAT
TGCCTTCGAAAATCATATCAAGTCCCTGGAGCGGGCTTTCAACGATGCTCGCCAGCAACACAAGGCAGCCAGAAC
CAGAAAGGAGCGTAAGAACCGAGAGCAATTCGTGGCCCTCCTTAAGGAGCTCAAATCCCAGGGTAAGATCAAGGC
GGGCACCAAGTGGATGAATATCTGCCCGATCATTAAGGATGACCCCAGATATCATGGCATCCTAGGCCAGCCTGG
TTCGACCCCTCTTGATTTGTTCTGGGATATGGTGGAGGAAGAAGAACGCGCTTTGCGAGGACCTCGGAACGACGT
GCTCGATGTTCTGGATGTAAGTTTCCCTCGGATCCAAGCAAAGACTATATGTCCTAACAAACTGATTCTAGGACA
AGCGATTTGAAGTTACGACTGAAACCACGTTTGACGAATTCAATTCTATCATGTCCGCCGACCGTCGCACCTCCA
AGATTGACCCTGAGATTCTCAATCTCATTTTCCAGCGCATCCAAGACAAGGCAGTTCGACGTACGGAGGATGAAA
AGCATGCAGCCGATCGTCAACAGCGTCGCGCCGTGGACGCACTGCGTTCTCGTATCAAGCGCCTAGAGCCGCCTG
TCCGGGTCACCGACACCTGGGCTGAAGTCCAACCTCGCCTTGAGAAATACGACGAATACAAGGCCATTGAGTCCG
ATGAAATTCGGGAGTCTGCCTTTGAAAAAGCAATTCGCCGCTTGAAAGAAAGAGATGAGGATGCAGAGAGGGAGC
GTGAGGTACACTCTCAAAGCCGTGGAAGCCGACGGGATTATGACCGCGGTGATCGTGAATATCGCAGTGGGCGAG
GAGAACGACGAGGACCCAGCGGCCAGACCAACCGGACCCCGGAAATGGATGCATACGAAGCAGACCGTCGCAAGG
CACAGGCCGACCGCGAACGAACTTACCGCAAGGTCAGCGGTATCTCCCCATCTCGTGATCGTCGCGATGAGCGTG
GAGACCGTTATCGTAGCCGGGACCGTGACTTTGACCGTCCCCGCGCTAGAGACCCAGACCGACGTGAAGACGAAC
GCGAGCGCCTTTACCGCACTCGTGGAGATCCCCGTGGAAGTCGTGATGAGCTTGATTATGGTGGTGGTACTGGTG
CTGTTGACACTCGCAGTGTGGCCAGTGGTGACCGCCGACGCCGACGTGACAGTGATACCGAGAGTGTGGCTAGCC
GTAAGCGGTACCGACGTGAGAGCCGTGAGCGCAGCAAGGGTCCGAGAGTCCCCCGACAGGAACGGTCCGCTATTC
CGGAAGAAGAGATCGAGGATGCGAAGAAAGATGAGAAGGCCATTCACTCTGGCAGCGAGGAAGGAGAGATTGAAG
AGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail