Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8531.t1
Gene name
Locationscaffold_19:187781..189025
Strand+
Gene length (bp)1244
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01214 CK_II_beta Casein kinase II regulatory subunit 1.4E-74 147 323

GO

GO Term Description Terminal node
GO:0005956 protein kinase CK2 complex Yes
GO:0019887 protein kinase regulator activity Yes
GO:0030234 enzyme regulator activity No
GO:0005575 cellular_component No
GO:0140535 intracellular protein-containing complex No
GO:0098772 molecular function regulator activity No
GO:0003674 molecular_function No
GO:0032991 protein-containing complex No
GO:0019207 kinase regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 41 63 22
3 133 150 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8531.t1
MVSWLSPQVVLFFVVFLGGAASALFQRASWYADHGDMDSCFLCVSFAITSVYFYVHLLCIYVQISLEVDLARFDP
NDPNGPRGSPGSDFNPGGQNKPPSGQSPQPSRRGPARGGSSTSSRFSDSPLSSYRSRAVLFMIMLIAIMYLQFVS
SRGNEYFCEIDEDYLTDRFNLTGLNTEVPYYQYALDLVTDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRG
LAKMLEKYKKSDFGKCPRVMCDGHALLPLGESDLPNASTVKLYCPKCEDIYNPKSSRHSSIDGAYFGTSFHSILF
QVYPALNPEKSSRRYEPRIYGFKVHAAAALARYQDNQREDLKWRLAEVDINHRFIEDSESDDDAFEYDEDYVEGH
VEQVKNDKLFGDAASLA*
Coding >Pro_DTO070G2_2|g8531.t1
ATGGTGTCTTGGCTGTCTCCACAAGTTGTCCTTTTCTTCGTGGTCTTCTTGGGCGGCGCAGCATCTGCGCTGTTC
CAACGCGCGTCTTGGTACGCGGACCATGGCGATATGGATTCTTGTTTCTTGTGTGTATCGTTCGCGATCACTTCG
GTCTACTTTTACGTCCATTTGCTCTGCATTTACGTCCAGATATCATTGGAAGTTGATCTAGCCAGGTTTGATCCA
AATGACCCCAATGGTCCCCGCGGCTCTCCTGGCTCGGATTTTAACCCCGGTGGACAAAATAAACCACCCAGTGGC
CAGTCACCCCAACCTTCACGGCGTGGCCCTGCGCGTGGAGGGTCTTCCACGTCCTCGCGTTTCTCCGATTCCCCT
CTGTCTAGTTACAGAAGCCGTGCAGTCTTATTCATGATTATGCTAATCGCAATCATGTATTTGCAGTTTGTCTCA
TCCCGTGGTAACGAATACTTCTGCGAGATTGACGAGGACTACCTAACCGATCGGTTCAACCTCACCGGTTTGAAC
ACCGAAGTTCCGTACTATCAGTACGCCCTTGATCTTGTGACCGACGTTTTCGATCTTGATGCCGACGACGATCTG
CGTGAGCAAATTGAAAAGTCTGCTCGTCACCTCTATGGCTTGGTTCATGCCCGGTACATTGTTACCACTCGTGGT
CTTGCCAAAATGCTTGAAAAGTACAAGAAGAGCGACTTCGGAAAGTGCCCACGCGTGATGTGTGATGGGCATGCT
TTGCTTCCTCTTGGCGAGTCCGATCTTCCGAATGCCAGCACCGTCAAGCTGTACTGCCCCAAGTGCGAAGACATC
TACAACCCGAAGTCGTCACGTCACTCGTCCATCGATGGTGCGTACTTCGGTACCTCGTTCCACTCCATTCTTTTC
CAGGTCTATCCGGCCCTCAATCCCGAGAAGAGCAGCCGTCGTTATGAACCCCGGATCTACGGCTTCAAGGTGCAC
GCCGCAGCTGCACTTGCTCGATACCAAGACAACCAGCGTGAGGATCTCAAGTGGCGTCTCGCCGAGGTCGATATC
AACCACAGGTTCATCGAGGATAGCGAGAGTGATGACGATGCATTCGAGTACGACGAAGATTATGTTGAAGGCCAC
GTGGAGCAAGTCAAGAACGACAAGCTCTTCGGTGATGCAGCTTCGCTCGCATGA
Transcript >Pro_DTO070G2_2|g8531.t1
ATGGTGTCTTGGCTGTCTCCACAAGTTGTCCTTTTCTTCGTGGTCTTCTTGGGCGGCGCAGCATCTGCGCTGTTC
CAACGCGCGTCTTGGTACGCGGACCATGGCGATATGGATTCTTGTTTCTTGTGTGTATCGTTCGCGATCACTTCG
GTCTACTTTTACGTCCATTTGCTCTGCATTTACGTCCAGATATCATTGGAAGTTGATCTAGCCAGGTTTGATCCA
AATGACCCCAATGGTCCCCGCGGCTCTCCTGGCTCGGATTTTAACCCCGGTGGACAAAATAAACCACCCAGTGGC
CAGTCACCCCAACCTTCACGGCGTGGCCCTGCGCGTGGAGGGTCTTCCACGTCCTCGCGTTTCTCCGATTCCCCT
CTGTCTAGTTACAGAAGCCGTGCAGTCTTATTCATGATTATGCTAATCGCAATCATGTATTTGCAGTTTGTCTCA
TCCCGTGGTAACGAATACTTCTGCGAGATTGACGAGGACTACCTAACCGATCGGTTCAACCTCACCGGTTTGAAC
ACCGAAGTTCCGTACTATCAGTACGCCCTTGATCTTGTGACCGACGTTTTCGATCTTGATGCCGACGACGATCTG
CGTGAGCAAATTGAAAAGTCTGCTCGTCACCTCTATGGCTTGGTTCATGCCCGGTACATTGTTACCACTCGTGGT
CTTGCCAAAATGCTTGAAAAGTACAAGAAGAGCGACTTCGGAAAGTGCCCACGCGTGATGTGTGATGGGCATGCT
TTGCTTCCTCTTGGCGAGTCCGATCTTCCGAATGCCAGCACCGTCAAGCTGTACTGCCCCAAGTGCGAAGACATC
TACAACCCGAAGTCGTCACGTCACTCGTCCATCGATGGTGCGTACTTCGGTACCTCGTTCCACTCCATTCTTTTC
CAGGTCTATCCGGCCCTCAATCCCGAGAAGAGCAGCCGTCGTTATGAACCCCGGATCTACGGCTTCAAGGTGCAC
GCCGCAGCTGCACTTGCTCGATACCAAGACAACCAGCGTGAGGATCTCAAGTGGCGTCTCGCCGAGGTCGATATC
AACCACAGGTTCATCGAGGATAGCGAGAGTGATGACGATGCATTCGAGTACGACGAAGATTATGTTGAAGGCCAC
GTGGAGCAAGTCAAGAACGACAAGCTCTTCGGTGATGCAGCTTCGCTCGCATGA
Gene >Pro_DTO070G2_2|g8531.t1
ATGGTGTCTTGGCTGTCTCCACAAGTTGTCCTTTTCTTCGTGGTCTTCTTGGGCGGCGCAGCATCTGCGCTGTTC
CAACGCGCGTCTTGGTACGCGGACCATGGCGATATGGATTCTTGTTTCTTGTGTGTATCGTTCGCGATCACTTCG
GTCTACTTTTACGTCCATTTGCTCTGCATTTACGTCCAGATATCATTGGAAGTTGATCTAGCCAGGTTTGATCCA
AATGACCCCAATGGTCCCCGCGGCTCTCCTGGCTCGGATTTTAACCCCGGTGGACAAAATAAACCACCCAGTGGC
CAGTCACCCCAACCTTCACGGCGTGGCCCTGCGCGTGGAGGGTCTTCCACGTCCTCGCGTTTCTCCGATTCCCCT
CTGTCTAGTTACAGAAGCCGTGCAGTCTTATTCATGATTATGCTAATCGCAATCATGTATTTGCAGTTTGTCTCA
TCCCGTGGTAACGAATACTTCTGCGAGATTGACGAGGACTACCTAACCGATCGGTTCAACCTCACCGGTTTGAAC
ACCGAAGTTCCGTACTATCAGTACGCCCTTGATCTTGTGACCGACGTTTTCGATCTTGATGCCGACGACGATCTG
CGTGAGCAAATTGAAAAGTCTGCTCGTCACCTCTATGGCTTGGTTCATGCCCGGTACATTGTTACCACTCGTGGT
CTTGCCAAAATGGTATGTTGAAATTCGGAACTTGTGTGCATGTTGTTTCCCAGACGAAAGTACTAACCTCCGTGC
AGCTTGAAAAGTACAAGAAGAGCGACTTCGGAAAGTGCCCACGCGTGATGTGTGATGGGCATGCTTTGCTTCCTC
TTGGCGAGTCCGATCTTCCGAATGCCAGCACCGTCAAGCTGTACTGCCCCAAGTGCGAAGACATCTACAACCCGA
AGTCGTCACGTCACTCGTCCATCGATGGTGCGTACTTCGGTACCTCGTTCCACTCCATTCTTTTCCAGGTCTATC
CGGCCCTCAATCCCGAGAAGAGCAGCCGTCGTTATGAACCCCGGATCTACGGCTTCAAGGTGCACGCCGCAGCTG
CACTTGCTCGATACCAAGACAACCAGCGTGAGGATCTCAAGTGGCGTCTCGCCGAGGTCGATATCAACCACAGGT
TCATCGAGGATAGCGAGAGTGATGACGATGCATTCGAGTACGACGAAGATTATGTTGAAGGCCACGTGGAGCAAG
TCAAGAACGACAAGCTCTTCGGTGATGCAGCTTCGCTCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail