Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8463.t1
Gene name
Locationscaffold_19:17652..19086
Strand-
Gene length (bp)1434
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.4E-62 32 474
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.4E-10 27 93

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8463.t1
MHLFVIAIPLCHVLVAECFIPKVDVAIIGGGLSGLSTAKDLAAANKSFVILEARDRVGGRVLNFNLTGKNIQELG
GEYVGPTQNRVLALAAELGLPTYKTYTTGNSTFYRNNTVHHYQDTLGGIPPVGIGSLIELAFFMNDINTLASKVD
LEAPWNTPNATALDSMTLETYVSSRLSTADSRVLLDIAIPAILSTELREPSLLYALWCIAAAGDKTGPGTINRLI
GVEGGAQDSRVSGGTQLLATLLAERLGSQNIYLNTPVRKVQLKKSRYLVSSDEVNISARHVVVAMSPPLASHIIF
DPLLPAGRDQLNQRMPMGALGKAIAIFPTAWWRDEGLNGEGVSDIGAIRVTYDNSPADDSFGAIMGFIEADEMRK
LDTASEEEVKRQVKQSFANLFGPRVENATDILVQRWDLEEFSRGGPSAFMPPGVLTQYGSYLRTPVGRIHFAGTE
TSLRWIGYMDGAISSGERVAGEILKTW*
Coding >Pro_DTO070G2_2|g8463.t1
ATGCACCTCTTCGTGATAGCAATTCCCCTTTGCCATGTACTGGTTGCAGAATGCTTCATCCCCAAAGTGGACGTC
GCCATCATCGGCGGTGGCCTATCCGGACTCTCCACCGCCAAAGACCTGGCAGCGGCCAACAAATCCTTCGTCATA
TTAGAAGCACGAGACCGAGTTGGTGGTCGCGTACTCAACTTCAACCTCACAGGAAAGAATATCCAAGAACTAGGC
GGCGAATATGTTGGACCAACACAAAACCGCGTTTTGGCTCTCGCGGCCGAACTCGGCCTCCCAACCTATAAGACA
TATACGACGGGAAATTCAACCTTCTATCGAAACAACACGGTTCACCATTATCAAGATACTTTGGGCGGTATTCCT
CCCGTGGGAATAGGCTCCCTTATTGAACTTGCATTCTTCATGAACGACATCAATACCCTAGCGAGCAAGGTCGAC
CTAGAAGCACCATGGAATACCCCGAATGCCACGGCGCTGGATTCAATGACTCTAGAAACATACGTCAGTTCCCGA
TTATCCACTGCCGACTCTCGCGTTCTCCTCGATATTGCCATCCCAGCTATACTGTCGACCGAACTGAGAGAACCG
TCTTTGCTGTATGCATTGTGGTGTATAGCTGCCGCTGGAGATAAAACAGGGCCTGGGACCATCAACCGTCTCATT
GGGGTGGAGGGGGGTGCACAGGATAGTCGGGTGAGTGGTGGAACACAGTTACTCGCAACACTTCTCGCCGAGAGA
CTCGGCTCGCAAAACATCTACCTGAACACGCCCGTGCGCAAAGTCCAGCTCAAAAAATCCCGCTATCTAGTCTCT
TCAGATGAGGTCAATATTTCAGCCCGACATGTTGTCGTCGCCATGTCCCCACCTCTAGCAAGCCACATCATATTC
GATCCCCTACTACCAGCCGGACGAGATCAGTTAAACCAGCGCATGCCCATGGGGGCACTTGGCAAAGCCATCGCG
ATCTTCCCGACAGCCTGGTGGCGGGATGAGGGACTCAACGGAGAAGGTGTGAGCGACATCGGGGCAATCCGAGTG
ACATACGACAACTCGCCGGCGGATGACTCGTTCGGAGCAATAATGGGGTTCATCGAGGCGGACGAGATGCGCAAG
CTGGATACTGCGAGCGAGGAGGAGGTAAAGCGTCAAGTCAAGCAGAGTTTTGCTAATCTCTTTGGTCCGCGCGTT
GAAAATGCCACCGATATCCTCGTTCAGAGGTGGGATCTTGAGGAGTTTTCCCGTGGTGGCCCCAGTGCTTTCATG
CCGCCGGGAGTTTTGACACAGTATGGGTCTTATTTACGTACTCCAGTTGGGAGGATCCATTTTGCCGGGACAGAG
ACTTCACTGAGGTGGATTGGGTATATGGATGGGGCTATTAGCTCGGGAGAACGGGTTGCTGGGGAGATACTGAAG
ACTTGGTGA
Transcript >Pro_DTO070G2_2|g8463.t1
ATGCACCTCTTCGTGATAGCAATTCCCCTTTGCCATGTACTGGTTGCAGAATGCTTCATCCCCAAAGTGGACGTC
GCCATCATCGGCGGTGGCCTATCCGGACTCTCCACCGCCAAAGACCTGGCAGCGGCCAACAAATCCTTCGTCATA
TTAGAAGCACGAGACCGAGTTGGTGGTCGCGTACTCAACTTCAACCTCACAGGAAAGAATATCCAAGAACTAGGC
GGCGAATATGTTGGACCAACACAAAACCGCGTTTTGGCTCTCGCGGCCGAACTCGGCCTCCCAACCTATAAGACA
TATACGACGGGAAATTCAACCTTCTATCGAAACAACACGGTTCACCATTATCAAGATACTTTGGGCGGTATTCCT
CCCGTGGGAATAGGCTCCCTTATTGAACTTGCATTCTTCATGAACGACATCAATACCCTAGCGAGCAAGGTCGAC
CTAGAAGCACCATGGAATACCCCGAATGCCACGGCGCTGGATTCAATGACTCTAGAAACATACGTCAGTTCCCGA
TTATCCACTGCCGACTCTCGCGTTCTCCTCGATATTGCCATCCCAGCTATACTGTCGACCGAACTGAGAGAACCG
TCTTTGCTGTATGCATTGTGGTGTATAGCTGCCGCTGGAGATAAAACAGGGCCTGGGACCATCAACCGTCTCATT
GGGGTGGAGGGGGGTGCACAGGATAGTCGGGTGAGTGGTGGAACACAGTTACTCGCAACACTTCTCGCCGAGAGA
CTCGGCTCGCAAAACATCTACCTGAACACGCCCGTGCGCAAAGTCCAGCTCAAAAAATCCCGCTATCTAGTCTCT
TCAGATGAGGTCAATATTTCAGCCCGACATGTTGTCGTCGCCATGTCCCCACCTCTAGCAAGCCACATCATATTC
GATCCCCTACTACCAGCCGGACGAGATCAGTTAAACCAGCGCATGCCCATGGGGGCACTTGGCAAAGCCATCGCG
ATCTTCCCGACAGCCTGGTGGCGGGATGAGGGACTCAACGGAGAAGGTGTGAGCGACATCGGGGCAATCCGAGTG
ACATACGACAACTCGCCGGCGGATGACTCGTTCGGAGCAATAATGGGGTTCATCGAGGCGGACGAGATGCGCAAG
CTGGATACTGCGAGCGAGGAGGAGGTAAAGCGTCAAGTCAAGCAGAGTTTTGCTAATCTCTTTGGTCCGCGCGTT
GAAAATGCCACCGATATCCTCGTTCAGAGGTGGGATCTTGAGGAGTTTTCCCGTGGTGGCCCCAGTGCTTTCATG
CCGCCGGGAGTTTTGACACAGTATGGGTCTTATTTACGTACTCCAGTTGGGAGGATCCATTTTGCCGGGACAGAG
ACTTCACTGAGGTGGATTGGGTATATGGATGGGGCTATTAGCTCGGGAGAACGGGTTGCTGGGGAGATACTGAAG
ACTTGGTGA
Gene >Pro_DTO070G2_2|g8463.t1
ATGCACCTCTTCGTGATAGCAATTCCCCTTTGCCATGTACTGGTTGCAGAATGCTTCATCCCCAAAGTGGACGTC
GCCATCATCGGCGGTGGCCTATCCGGACTCTCCACCGCCAAAGACCTGGCAGCGGCCAACAAATCCTTCGTCATA
TTAGAAGCACGAGACCGAGTTGGTGGTCGCGTACTCAACTTCAACCTCACAGGAAAGAATATCCAAGAACTAGGC
GGCGAATATGTTGGACCAACACAAAACCGCGTTTTGGCTCTCGCGGCCGAACTCGGCCTCCCAACCTATAAGACA
TATACGACGGGAAATTCAACCTTCTATCGAAACAACACGGTTCACCATTATCAAGATACTTTGGGCGGTATTCCT
CCCGTGGGAATAGGCTCCCTTATTGAACTTGCATTCTTCATGAACGACATCAATACCCTAGCGAGCAAGGTCGAC
CTAGAAGCACCATGGAATACCCCGAATGCCACGGCGCTGGATTCAATGACTCTAGAAACATACGTCAGTTCCCGA
TTATCCACTGCCGACTCTCGCGTTCTCCTCGATATTGCCATCCCAGCTATACTGTCGACCGAACTGAGAGAACCG
TCTTTGCTGTATGCATTGTGGTGTATAGCTGCCGCTGGAGATAAAACAGGGCCTGGGACCATCAACCGTCTCATT
GGGGTGGAGGGGGGTGCACAGGATAGTCGGGTGAGTGGTGGAACACAGTTACTCGCAACACTTCTCGCCGAGAGA
CTCGGCTCGCAAAACATCTACCTGAACACGCCCGTGCGCAAAGTCCAGCTCAAAAAATCCCGCTATCTAGTCTCT
TCAGATGAGGTCAATATTTCAGCCCGACATGTTGTCGTCGCCATGTCCCCACCTCTAGCAAGCCACATCATATTC
GATCCCCTACTACCAGCCGGACGAGATCAGTTAAACCAGCGCATGCCCATGGGGGCACTTGGCAAAGCCATCGCG
ATCTTCCCGACAGCCTGGTGGCGGGATGAGGGACTCAACGGAGAAGGTGTGAGCGACATCGGGGCAATCCGAGTG
ACATACGACAACTCGCCGGCGGATGACTCGTTCGGAGCAATAATGGGGTTCATCGAGGCGGACGAGATGCGCAAG
CTGGATACTGCGAGCGAGGAGGAGGTAAAGCGTCAAGTCAAGCAGAGTTTTGCTAATCTCTTTGGTCCGCGCGTT
GAAAATGCCACCGATATCCTCGTTCAGAGGTGGGATCTTGAGGAGTTTTCCCGTGGTGGCCCCAGTGCTTTCATG
CCGCCGGGAGTTTTGACACAGTATGGGTCTTATTTACGTACTCCAGTTGGGAGGATCCATTTTGCCGGGACAGAG
ACTTCACTGAGGTGGATTGGGTATATGGATGGGGCTATTAGCTCGGGAGAACGGGTTGCTGGGGAGATACTGAAG
ACTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail