Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8358.t1
Gene name
Locationscaffold_18:117468..118599
Strand+
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 4.2E-27 213 361
PF03476 MOSC_N MOSC N-terminal beta barrel domain 1.8E-19 47 184

GO

GO Term Description Terminal node
GO:0030151 molybdenum ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0036094 small molecule binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0019842 vitamin binding No
GO:0070279 vitamin B6 binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 2 19 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8358.t1
MVSAVILGLLLLIPIILIPRFKGWPKSVQSPTKLLRLWRQRPKQSSEIVSLRMYPIKSCRGLEVQSTVLKQHGLD
LDRRWMLIDASSNTFLTIRQIPDMTRIRTAISADGDELVVSIPKPEINKPSQYQGQDHHFHTIRIPSHPSPQWLA
ANTNTGPVHIWDTETDGYRYNKEINAPFSAFLRRDVALVYKGPAPRVLKGNGAPRYLGRVQTTGFADVHPVLIAS
EASLAELNVRLVRVGVDPITVERFRPNIVVRGGAPWSEDSWKLVRITGRNASGTFIGSAGSGEAVIQSPLDLDIV
ARCARCQVPNVDPDTALKNKKEPWDTLVSYRRVDEGIRYKPCFGMLSAPRNEGAIEVGMRLEVLEETNEHRYITG
F*
Coding >Pro_DTO070G2_2|g8358.t1
ATGGTGTCAGCAGTGATATTAGGCCTTCTGCTCCTAATTCCAATCATCCTGATTCCGCGCTTCAAAGGATGGCCC
AAATCAGTCCAATCCCCTACCAAACTTCTCCGCCTATGGCGCCAGCGCCCCAAACAATCCAGCGAAATCGTCTCG
CTGCGCATGTACCCCATAAAATCCTGTAGAGGCCTAGAAGTCCAATCAACGGTCCTTAAACAGCATGGTCTTGAC
CTTGACCGCCGCTGGATGCTCATTGACGCATCCTCAAATACGTTTCTAACCATCCGCCAAATCCCCGACATGACC
CGCATTCGCACCGCGATAAGTGCCGACGGCGACGAGTTGGTCGTGAGTATACCGAAACCCGAAATCAACAAACCC
AGCCAATACCAAGGCCAAGACCATCATTTTCATACCATCCGCATCCCTTCCCATCCATCACCGCAATGGCTAGCG
GCAAATACAAATACGGGCCCCGTCCACATCTGGGACACAGAGACAGACGGGTACAGGTACAACAAGGAAATCAAC
GCTCCCTTCTCTGCTTTCCTGCGCCGCGACGTCGCTCTCGTCTACAAGGGCCCGGCTCCGCGCGTGCTGAAGGGT
AACGGCGCCCCCCGCTACCTAGGCCGCGTCCAAACAACCGGCTTTGCGGACGTGCATCCGGTGTTGATTGCGTCG
GAGGCTTCGCTGGCAGAGCTCAATGTTCGTCTGGTAAGGGTGGGCGTCGACCCGATTACTGTCGAGCGGTTCCGT
CCGAATATCGTTGTTCGCGGCGGGGCGCCGTGGAGTGAGGATTCGTGGAAGTTGGTTCGCATTACTGGTCGAAAT
GCTAGCGGTACTTTTATTGGTTCCGCTGGTAGCGGAGAGGCTGTTATTCAGTCTCCGCTTGACCTGGATATTGTG
GCTCGCTGTGCGCGCTGCCAGGTGCCTAATGTTGATCCAGATACGGCGCTCAAGAATAAGAAGGAGCCGTGGGAT
ACACTTGTTTCGTACCGTAGGGTGGATGAGGGGATTAGGTATAAGCCTTGTTTTGGTATGTTGAGTGCGCCGCGT
AATGAGGGGGCTATTGAGGTTGGGATGAGGTTGGAGGTTTTGGAAGAGACGAATGAGCATCGATATATTACTGGC
TTTTAG
Transcript >Pro_DTO070G2_2|g8358.t1
ATGGTGTCAGCAGTGATATTAGGCCTTCTGCTCCTAATTCCAATCATCCTGATTCCGCGCTTCAAAGGATGGCCC
AAATCAGTCCAATCCCCTACCAAACTTCTCCGCCTATGGCGCCAGCGCCCCAAACAATCCAGCGAAATCGTCTCG
CTGCGCATGTACCCCATAAAATCCTGTAGAGGCCTAGAAGTCCAATCAACGGTCCTTAAACAGCATGGTCTTGAC
CTTGACCGCCGCTGGATGCTCATTGACGCATCCTCAAATACGTTTCTAACCATCCGCCAAATCCCCGACATGACC
CGCATTCGCACCGCGATAAGTGCCGACGGCGACGAGTTGGTCGTGAGTATACCGAAACCCGAAATCAACAAACCC
AGCCAATACCAAGGCCAAGACCATCATTTTCATACCATCCGCATCCCTTCCCATCCATCACCGCAATGGCTAGCG
GCAAATACAAATACGGGCCCCGTCCACATCTGGGACACAGAGACAGACGGGTACAGGTACAACAAGGAAATCAAC
GCTCCCTTCTCTGCTTTCCTGCGCCGCGACGTCGCTCTCGTCTACAAGGGCCCGGCTCCGCGCGTGCTGAAGGGT
AACGGCGCCCCCCGCTACCTAGGCCGCGTCCAAACAACCGGCTTTGCGGACGTGCATCCGGTGTTGATTGCGTCG
GAGGCTTCGCTGGCAGAGCTCAATGTTCGTCTGGTAAGGGTGGGCGTCGACCCGATTACTGTCGAGCGGTTCCGT
CCGAATATCGTTGTTCGCGGCGGGGCGCCGTGGAGTGAGGATTCGTGGAAGTTGGTTCGCATTACTGGTCGAAAT
GCTAGCGGTACTTTTATTGGTTCCGCTGGTAGCGGAGAGGCTGTTATTCAGTCTCCGCTTGACCTGGATATTGTG
GCTCGCTGTGCGCGCTGCCAGGTGCCTAATGTTGATCCAGATACGGCGCTCAAGAATAAGAAGGAGCCGTGGGAT
ACACTTGTTTCGTACCGTAGGGTGGATGAGGGGATTAGGTATAAGCCTTGTTTTGGTATGTTGAGTGCGCCGCGT
AATGAGGGGGCTATTGAGGTTGGGATGAGGTTGGAGGTTTTGGAAGAGACGAATGAGCATCGATATATTACTGGC
TTTTAG
Gene >Pro_DTO070G2_2|g8358.t1
ATGGTGTCAGCAGTGATATTAGGCCTTCTGCTCCTAATTCCAATCATCCTGATTCCGCGCTTCAAAGGATGGCCC
AAATCAGTCCAATCCCCTACCAAACTTCTCCGCCTATGGCGCCAGCGCCCCAAACAATCCAGCGAAATCGTCTCG
CTGCGCATGTACCCCATAAAATCCTGTAGAGGCCTAGAAGTCCAATCAACGGTCCTTAAACAGCATGGTCTTGAC
CTTGACCGCCGCTGGATGCTCATTGACGCATCCTCAAATACGTTTCTAACCATCCGCCAAATCCCCGACATGACC
CGCATTCGCACCGCGATAAGTGCCGACGGCGACGAGTTGGTCGTGAGTATACCGAAACCCGAAATCAACAAACCC
AGCCAATACCAAGGCCAAGACCATCATTTTCATACCATCCGCATCCCTTCCCATCCATCACCGCAATGGCTAGCG
GCAAATACAAATACGGGCCCCGTCCACATCTGGGACACAGAGACAGACGGGTACAGGTACAACAAGGAAATCAAC
GCTCCCTTCTCTGCTTTCCTGCGCCGCGACGTCGCTCTCGTCTACAAGGGCCCGGCTCCGCGCGTGCTGAAGGGT
AACGGCGCCCCCCGCTACCTAGGCCGCGTCCAAACAACCGGCTTTGCGGACGTGCATCCGGTGTTGATTGCGTCG
GAGGCTTCGCTGGCAGAGCTCAATGTTCGTCTGGTAAGGGTGGGCGTCGACCCGATTACTGTCGAGCGGTTCCGT
CCGAATATCGTTGTTCGCGGCGGGGCGCCGTGGAGTGAGGATTCGTGGAAGTTGGTTCGCATTACTGGTCGAAAT
GCTAGCGGTACTTTTATTGGTTCCGCTGGTAGCGGAGAGGCTGTTATTCAGTCTCCGCTTGACCTGGATATTGTG
GCTCGCTGTGCGCGCTGCCAGGTGCCTAATGTTGATCCAGATACGGCGCTCAAGAATAAGAAGGAGCCGTGGGAT
ACACTTGTTTCGTACCGTAGGGTGGATGAGGGGATTAGGTATAAGCCTTGTTTTGGTATGTTGAGTGCGCCGCGT
AATGAGGGGGCTATTGAGGTTGGGATGAGGTTGGAGGTTTTGGAAGAGACGAATGAGCATCGATATATTACTGGC
TTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail