Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8336.t1
Gene name
Locationscaffold_18:54058..55611
Strand-
Gene length (bp)1553
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.1E-17 176 401
PF14008 Metallophos_C Iron/zinc purple acid phosphatase-like protein C 1.5E-13 423 484
PF16656 Pur_ac_phosph_N Purple acid Phosphatase, N-terminal domain 1.3E-12 33 117

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0046872 metal ion binding Yes
GO:0003993 acid phosphatase activity Yes
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0043169 cation binding No
GO:0042578 phosphoric ester hydrolase activity No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8336.t1
MGGILSLKLLPFVASCAFAGVNYPEIPKDLTTPFQQRLTVYGPNAVSVGWNTYEQLNQSCVNYGLSETNLNTKAC
SSSSTTYDPSRTWSNVAVLTGLTPATTYYYKIDSTNSTIGHFLSPRTPGDRTAFTMDVIIDLGVYGKDGFTSKRN
TKKDTIPVIEPELNHTTIGRLAETIDDYELVIHPGDFAYADDWYLKFANLLDGKEAYESIIEQFYDQLAPIAGRK
LYMASPGNHEADCSEIPYLNGLCPKGQNNFTEFMHRYEKTMPQSFISSSPNPTAQTLARTARSLSNPPFWYSFEY
GMAHVVMIDTETDFPNAPSGQGGSAKLNGGPFGTANQQIEFLKADLASVDRSVTPWLIVAGHRPWYSTGGSSNVC
SPCQEAFEGLLYQYGVDIGIFGHVHNSQRFMPVVNGTADPNGMEDPKAPMYIVAGGPGNVEGLSSVGSKPAYTEF
AYADDYSYSTLRFLDEQHLQVDFVRSSTGEILDSSTLYKEHATDFVDQ*
Coding >Pro_DTO070G2_2|g8336.t1
ATGGGGGGAATTCTATCGCTCAAATTGCTGCCCTTTGTGGCTAGCTGCGCCTTTGCTGGTGTCAATTATCCTGAG
ATCCCGAAGGACTTGACTACACCATTCCAGCAACGATTGACAGTCTATGGACCTAATGCTGTGTCGGTTGGTTGG
AACACCTATGAACAGCTGAATCAAAGTTGTGTGAATTATGGCTTGTCAGAAACCAACCTGAATACCAAAGCTTGC
TCATCCTCGTCGACTACCTACGATCCTTCCCGGACGTGGTCAAATGTTGCAGTCCTAACAGGCCTGACCCCCGCG
ACAACCTACTACTACAAGATTGACTCCACCAACTCGACCATAGGCCATTTTCTCAGCCCTCGCACGCCCGGCGAT
AGAACTGCATTCACCATGGACGTGATCATTGATCTTGGTGTCTACGGCAAAGACGGCTTCACAAGCAAAAGAAAC
ACAAAAAAGGACACTATTCCAGTCATCGAGCCAGAATTGAACCACACCACAATTGGTCGCCTCGCGGAAACAATA
GACGACTACGAGCTTGTCATCCACCCAGGCGATTTCGCTTACGCCGACGACTGGTATCTTAAATTCGCAAACCTG
CTCGACGGCAAAGAAGCCTACGAGTCTATTATCGAACAATTCTACGACCAACTAGCACCGATCGCAGGCCGCAAG
CTCTACATGGCCAGCCCGGGAAACCACGAAGCAGACTGCTCAGAGATTCCATACTTGAACGGCCTCTGCCCAAAA
GGCCAGAACAACTTCACCGAGTTCATGCACCGGTACGAGAAAACCATGCCGCAGTCTTTTATTTCGTCGTCACCA
AACCCAACGGCCCAAACCCTGGCCCGAACGGCCCGCAGCCTTTCCAACCCACCCTTTTGGTATTCCTTCGAATAC
GGCATGGCCCACGTTGTGATGATCGACACCGAAACGGATTTCCCAAATGCACCAAGCGGCCAAGGTGGCTCCGCC
AAGCTGAACGGCGGGCCATTTGGCACTGCGAACCAACAGATCGAGTTCCTCAAGGCCGATCTCGCTTCCGTCGAC
CGGTCTGTCACACCTTGGCTAATCGTCGCCGGACACAGGCCATGGTACTCAACCGGAGGATCGTCGAACGTCTGC
AGTCCCTGCCAAGAGGCGTTTGAGGGCCTGCTTTACCAGTACGGCGTTGACATCGGTATTTTTGGGCATGTGCAC
AACTCGCAGCGGTTCATGCCTGTGGTCAATGGTACCGCCGATCCCAACGGTATGGAGGACCCCAAGGCCCCCATG
TATATCGTTGCTGGAGGCCCCGGTAATGTTGAGGGTCTGAGCTCTGTTGGCAGTAAGCCTGCTTATACGGAGTTT
GCATATGCGGATGACTATAGCTACAGTACGCTTAGGTTTTTGGATGAGCAACACTTGCAAGTTGATTTTGTGAGG
TCCTCTACTGGAGAGATCTTGGATTCTAGTACTTTGTACAAGGAACATGCAACGGATTTTGTGGACCAGTAA
Transcript >Pro_DTO070G2_2|g8336.t1
ATGGGGGGAATTCTATCGCTCAAATTGCTGCCCTTTGTGGCTAGCTGCGCCTTTGCTGGTGTCAATTATCCTGAG
ATCCCGAAGGACTTGACTACACCATTCCAGCAACGATTGACAGTCTATGGACCTAATGCTGTGTCGGTTGGTTGG
AACACCTATGAACAGCTGAATCAAAGTTGTGTGAATTATGGCTTGTCAGAAACCAACCTGAATACCAAAGCTTGC
TCATCCTCGTCGACTACCTACGATCCTTCCCGGACGTGGTCAAATGTTGCAGTCCTAACAGGCCTGACCCCCGCG
ACAACCTACTACTACAAGATTGACTCCACCAACTCGACCATAGGCCATTTTCTCAGCCCTCGCACGCCCGGCGAT
AGAACTGCATTCACCATGGACGTGATCATTGATCTTGGTGTCTACGGCAAAGACGGCTTCACAAGCAAAAGAAAC
ACAAAAAAGGACACTATTCCAGTCATCGAGCCAGAATTGAACCACACCACAATTGGTCGCCTCGCGGAAACAATA
GACGACTACGAGCTTGTCATCCACCCAGGCGATTTCGCTTACGCCGACGACTGGTATCTTAAATTCGCAAACCTG
CTCGACGGCAAAGAAGCCTACGAGTCTATTATCGAACAATTCTACGACCAACTAGCACCGATCGCAGGCCGCAAG
CTCTACATGGCCAGCCCGGGAAACCACGAAGCAGACTGCTCAGAGATTCCATACTTGAACGGCCTCTGCCCAAAA
GGCCAGAACAACTTCACCGAGTTCATGCACCGGTACGAGAAAACCATGCCGCAGTCTTTTATTTCGTCGTCACCA
AACCCAACGGCCCAAACCCTGGCCCGAACGGCCCGCAGCCTTTCCAACCCACCCTTTTGGTATTCCTTCGAATAC
GGCATGGCCCACGTTGTGATGATCGACACCGAAACGGATTTCCCAAATGCACCAAGCGGCCAAGGTGGCTCCGCC
AAGCTGAACGGCGGGCCATTTGGCACTGCGAACCAACAGATCGAGTTCCTCAAGGCCGATCTCGCTTCCGTCGAC
CGGTCTGTCACACCTTGGCTAATCGTCGCCGGACACAGGCCATGGTACTCAACCGGAGGATCGTCGAACGTCTGC
AGTCCCTGCCAAGAGGCGTTTGAGGGCCTGCTTTACCAGTACGGCGTTGACATCGGTATTTTTGGGCATGTGCAC
AACTCGCAGCGGTTCATGCCTGTGGTCAATGGTACCGCCGATCCCAACGGTATGGAGGACCCCAAGGCCCCCATG
TATATCGTTGCTGGAGGCCCCGGTAATGTTGAGGGTCTGAGCTCTGTTGGCAGTAAGCCTGCTTATACGGAGTTT
GCATATGCGGATGACTATAGCTACAGTACGCTTAGGTTTTTGGATGAGCAACACTTGCAAGTTGATTTTGTGAGG
TCCTCTACTGGAGAGATCTTGGATTCTAGTACTTTGTACAAGGAACATGCAACGGATTTTGTGGACCAGTAA
Gene >Pro_DTO070G2_2|g8336.t1
ATGGGGGGAATTCTATCGCTCAAATTGCTGCCCTTTGTGGCTAGCTGCGCCTTTGCTGGTGTCAATTATCCTGAG
ATCCCGAAGGACTTGACTACACCATTCCAGCAACGATTGACAGTCTATGGACCTAATGGTAAGAAGACCGGTAGA
TATAGTGGGCTTGGAGAGGACTGACTTATTCATCTTTAGCTGTGTCGGTTGGTTGGAACACCTATGAACAGCTGA
ATCAAAGTTGTGTGAATTATGGCTTGTCAGAAACCAACCTGAATACCAAAGCTTGCTCATCCTCGTCGACTACCT
ACGATCCTTCCCGGACGTGGTCAAATGTTGCAGTCCTAACAGGCCTGACCCCCGCGACAACCTACTACTACAAGA
TTGACTCCACCAACTCGACCATAGGCCATTTTCTCAGCCCTCGCACGCCCGGCGATAGAACTGCATTCACCATGG
ACGTGATCATTGATCTTGGTGTCTACGGCAAAGACGGCTTCACAAGCAAAAGAAACACAAAAAAGGACACTATTC
CAGTCATCGAGCCAGAATTGAACCACACCACAATTGGTCGCCTCGCGGAAACAATAGACGACTACGAGCTTGTCA
TCCACCCAGGCGATTTCGCTTACGCCGACGACTGGTATCTTAAATTCGCAAACCTGCTCGACGGCAAAGAAGCCT
ACGAGTCTATTATCGAACAATTCTACGACCAACTAGCACCGATCGCAGGCCGCAAGCTCTACATGGCCAGCCCGG
GAAACCACGAAGCAGACTGCTCAGAGATTCCATACTTGAACGGCCTCTGCCCAAAAGGCCAGAACAACTTCACCG
AGTTCATGCACCGGTACGAGAAAACCATGCCGCAGTCTTTTATTTCGTCGTCACCAAACCCAACGGCCCAAACCC
TGGCCCGAACGGCCCGCAGCCTTTCCAACCCACCCTTTTGGTATTCCTTCGAATACGGCATGGCCCACGTTGTGA
TGATCGACACCGAAACGGATTTCCCAAATGCACCAAGCGGCCAAGGTGGCTCCGCCAAGCTGAACGGCGGGCCAT
TTGGCACTGCGAACCAACAGATCGAGTTCCTCAAGGCCGATCTCGCTTCCGTCGACCGGTCTGTCACACCTTGGC
TAATCGTCGCCGGACACAGGCCATGGTACTCAACCGGAGGATCGTCGAACGTCTGCAGTCCCTGCCAAGAGGCGT
TTGAGGGCCTGCTTTACCAGTACGGCGTTGACATCGGTATTTTTGGGCATGTGCACAACTCGCAGCGGTTCATGC
CTGTGGTCAATGGTACCGCCGATCCCAACGGTATGGAGGACCCCAAGGCCCCCATGTATATCGTTGCTGGAGGCC
CCGGTAATGTTGAGGGTCTGAGCTCTGTTGGCAGTAAGCCTGCTTATACGGAGTTTGCATATGCGGATGACTATA
GCTACAGTACGCTTAGGTTTTTGGATGAGCAACACTTGCAAGTTGATTTTGTGAGGTCCTCTACTGGAGAGATCT
TGGATTCTAGTACTTTGTACAAGGAACATGCAACGGATTTTGTGGACCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail