Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8233.t1
Gene name
Locationscaffold_17:220732..221717
Strand-
Gene length (bp)985
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06699 PIG-F GPI biosynthesis protein family Pig-F 1.3E-66 43 261

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0005575 cellular_component No
GO:0006505 GPI anchor metabolic process No
GO:0031090 organelle membrane No
GO:0006650 glycerophospholipid metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0016020 membrane No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0046467 membrane lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006629 lipid metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006497 protein lipidation No
GO:0006664 glycolipid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0009247 glycolipid biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 178 200 22
3 212 229 17
4 239 261 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4420
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g499.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g6307.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g7218.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g8216.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g8583.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g7542.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g9660.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g2491.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g627.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g1933.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g2012.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g4343.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g2182.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g9204.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g2631.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g3313.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g2252.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g2816.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g8233.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g3296.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g2595.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7806.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g2966.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g7100.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g4832.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g6277.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g4096.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g999.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g3240.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g5367.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g5963.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g5519.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g2813.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g8826.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8233.t1
MPQDTSSALGAPSSTPQTLVEKPSAPPVNILPSLIARIYSIAHPALLLALGATRFEALVANPTKELLSTLPWLTL
IQIFYVIVCLPPAGSTSTETSASAPTDVKSSPRPSGPGGAARHGKHGKRKQHANSWACIWSRSLPALLSVSLTFV
LATPVLTILLVLFGAPLTTHNSETILCAAHMAVLSATALIYAHGLDRGVWNEVWGIARPADAVWGSALGTGLGAW
FGAIPIPLDWDRPWQAFPITILVGAYIGYAIGSLLSRTPLVYGKRVKFTSEDLSETEKKIN*
Coding >Pro_DTO070G2_2|g8233.t1
ATGCCCCAAGACACCTCTTCCGCGCTAGGGGCTCCTTCCTCAACACCCCAGACGCTCGTCGAGAAACCTTCCGCC
CCTCCCGTCAACATCCTCCCCTCGTTGATAGCCCGGATCTACTCAATTGCGCATCCGGCACTCCTTTTGGCATTG
GGTGCCACTCGTTTCGAAGCATTGGTGGCTAATCCTACTAAGGAGCTTCTTTCCACCCTACCATGGCTCACCCTT
ATACAAATCTTCTACGTGATTGTATGTCTTCCGCCCGCTGGGTCGACATCAACAGAGACGAGCGCGTCCGCCCCG
ACTGATGTGAAGTCAAGTCCTCGGCCATCTGGGCCTGGTGGTGCCGCGCGACATGGCAAACATGGAAAGCGGAAG
CAGCACGCCAATAGCTGGGCATGCATTTGGTCTCGGTCACTGCCGGCCCTCCTCTCGGTCTCCCTGACCTTCGTC
TTGGCCACCCCGGTTCTGACAATCCTCCTGGTTCTATTCGGCGCCCCGCTCACAACCCACAATTCCGAGACCATC
CTGTGTGCGGCCCACATGGCCGTTCTATCCGCGACGGCCCTGATCTACGCCCACGGGTTGGACCGCGGCGTATGG
AACGAGGTTTGGGGCATTGCCCGACCCGCTGATGCGGTCTGGGGCAGTGCGCTCGGTACAGGCTTGGGGGCGTGG
TTTGGCGCTATTCCTATTCCTCTTGACTGGGACCGACCTTGGCAGGCATTCCCAATTACGATTCTTGTTGGAGCC
TACATCGGATATGCCATTGGCTCCTTGCTTTCTCGTACTCCATTGGTTTACGGCAAGCGTGTCAAATTCACCTCG
GAGGACTTGAGCGAAACCGAAAAGAAAATCAACTAG
Transcript >Pro_DTO070G2_2|g8233.t1
ATGCCCCAAGACACCTCTTCCGCGCTAGGGGCTCCTTCCTCAACACCCCAGACGCTCGTCGAGAAACCTTCCGCC
CCTCCCGTCAACATCCTCCCCTCGTTGATAGCCCGGATCTACTCAATTGCGCATCCGGCACTCCTTTTGGCATTG
GGTGCCACTCGTTTCGAAGCATTGGTGGCTAATCCTACTAAGGAGCTTCTTTCCACCCTACCATGGCTCACCCTT
ATACAAATCTTCTACGTGATTGTATGTCTTCCGCCCGCTGGGTCGACATCAACAGAGACGAGCGCGTCCGCCCCG
ACTGATGTGAAGTCAAGTCCTCGGCCATCTGGGCCTGGTGGTGCCGCGCGACATGGCAAACATGGAAAGCGGAAG
CAGCACGCCAATAGCTGGGCATGCATTTGGTCTCGGTCACTGCCGGCCCTCCTCTCGGTCTCCCTGACCTTCGTC
TTGGCCACCCCGGTTCTGACAATCCTCCTGGTTCTATTCGGCGCCCCGCTCACAACCCACAATTCCGAGACCATC
CTGTGTGCGGCCCACATGGCCGTTCTATCCGCGACGGCCCTGATCTACGCCCACGGGTTGGACCGCGGCGTATGG
AACGAGGTTTGGGGCATTGCCCGACCCGCTGATGCGGTCTGGGGCAGTGCGCTCGGTACAGGCTTGGGGGCGTGG
TTTGGCGCTATTCCTATTCCTCTTGACTGGGACCGACCTTGGCAGGCATTCCCAATTACGATTCTTGTTGGAGCC
TACATCGGATATGCCATTGGCTCCTTGCTTTCTCGTACTCCATTGGTTTACGGCAAGCGTGTCAAATTCACCTCG
GAGGACTTGAGCGAAACCGAAAAGAAAATCAACTAG
Gene >Pro_DTO070G2_2|g8233.t1
ATGCCCCAAGACACCTCTTCCGCGCTAGGGGCTCCTTCCTCAACACCCCAGACGCTCGTCGAGAAACCTTCCGCC
CCTCCCGTCAACATCCTCCCCTCGTTGATAGCCCGGATCTACTCAATTGCGCATCCGGCACTCCTTTTGGCATTG
GGTGCCACTCGTTTCGAAGCATTGGTGGCTAATCCTACTAAGGAGCTTCTTTCCACCCTACCATGGCTCACCCTT
ATACAAATCTTCTACGTGATTGTATGTCTTCCGCCCGCTGGGTCGACATCAACAGAGACGAGCGCGTCCGCCCCG
ACTGATGTGAAGTCAAGTCCTCGGCCATCTGGGCCTGGTGGTGCCGCGCGACATGGCAAACATGGAAAGCGGAAG
CAGCACGCCAATAGCTGGGCATGCATTTGGTCTCGGTCACTGGTACGCGATATCTCTCCAATTAAGCGGAACCTG
CGTGTGATTGATACTAACACGATTTTCTAGCCGGCCCTCCTCTCGGTCTCCCTGACCTTCGTCTTGGCCACCCCG
GTTCTGACAATCCTCCTGGTTCTATTCGGCGCCCCGCTCACAACCCACAATTCCGAGACCATCCTGTGTGCGGCC
CACATGGCCGTTCTATCCGCGACGGCCCTGATCTACGCCCACGGGTTGGACCGCGGCGTATGGAACGAGGTTTGG
GGCATTGCCCGACCCGCTGATGCGGTCTGGGGCAGTGCGCTCGGTACAGGCTTGGGGGCGTGGTTTGGCGCTATT
CCTATTCCTCTTGACTGGTATGTATACGTTCATACTGCACTTCAAATGCGGAATACCTGGCTAACTCGGTATATG
AAGGGACCGACCTTGGCAGGCATTCCCAATTACGATTCTTGTTGGAGCCTACATCGGATATGCCATTGGCTCCTT
GCTTTCTCGTACTCCATTGGTTTACGGCAAGCGTGTCAAATTCACCTCGGAGGACTTGAGCGAAACCGAAAAGAA
AATCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail