Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8150.t1
Gene name
Locationscaffold_16:464135..466187
Strand-
Gene length (bp)2052
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07885 Ion_trans_2 Ion channel 1.2E-12 213 286
PF07885 Ion_trans_2 Ion channel 2.2E-16 370 445

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 94 116 22
3 129 151 22
4 166 188 22
5 208 227 19
6 263 285 22
7 360 382 22
8 392 414 22
9 421 440 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8150.t1
MNEPGFDDAIADEAVALDRTASSPNQKIDEINKLSQHDTEYQQAARWWLASTAYPLVAGTFGPMASAFNICSLSQ
PWRMDLTSSGGTDIPDPKWVTAINAISLVFALVANLALSLTMARRIRFEIAQPIIVVGWYISSAFLIAILIPFGV
NMYKPENNGRIYSQSYYYGTFAAGLYFIIASLMAVTGYGAYRGYSSRKFNLTTSQRTLMLQTIIFCFYLLGGAAV
YSKVEGWRFLDAVYFADYTLLTIGVGNFSPSTHLGRGLLFPYAIGGIIILGLIISSIRTLMLENGKQKIGNMLTA
QTRKYLLREAFSDRSGAKGIIPSLGKKSAKAEGRSEREQRKREFIAMRQVCKLANVQHKWLSLLLSFLLWMTIWL
IGGVVFWRSESNAKWSYFEALYFAYTSLLTVGYGDLYPISSLGKSFFVFWSLLAVPTITILISNIGDTVIRFIRD
VTLFIGELTILPGDHSFVDRLKTLTHISWVRWWMEETTGEKEGAQQHAQFSQNQDPNKENGNDFDFKNNKEEKQA
ENIHQYIYLLFRELRKIIEYASNTPSRKFDYLEWEYYMSLIEGDNKPKVLGDEANDGQAQAAREWSWTDQENPLL
AETSEVQWLLGRLTEVLDRELRRASQVHHVSERAKGDGAED*
Coding >Pro_DTO070G2_2|g8150.t1
ATGAACGAACCTGGTTTCGATGACGCCATTGCCGACGAAGCAGTGGCTCTCGACCGCACCGCCAGCTCTCCAAAT
CAGAAGATAGACGAAATCAATAAGTTGTCGCAACATGATACCGAGTACCAGCAAGCTGCGCGTTGGTGGCTCGCA
AGTACGGCATACCCTCTAGTAGCTGGCACTTTCGGGCCGATGGCTAGCGCTTTCAATATCTGTTCTTTATCACAA
CCATGGCGAATGGACCTCACCAGCAGCGGTGGGACAGATATCCCGGATCCAAAATGGGTCACCGCTATCAACGCA
ATATCACTTGTCTTTGCACTTGTCGCCAACCTAGCCCTCTCGCTTACCATGGCCCGACGCATCCGTTTCGAAATC
GCCCAGCCAATCATCGTCGTAGGGTGGTACATCTCATCGGCGTTCTTGATCGCAATCTTAATTCCCTTCGGCGTG
AACATGTACAAGCCCGAGAACAACGGTCGAATCTACTCGCAGAGTTATTACTATGGCACATTCGCAGCAGGGTTA
TATTTCATCATCGCGTCATTAATGGCAGTGACTGGATATGGTGCCTACCGTGGCTACTCTAGCCGAAAATTCAAT
CTGACTACGAGCCAACGAACACTCATGCTGCAAACTATCATTTTCTGCTTCTATCTTCTGGGCGGTGCAGCCGTC
TACTCTAAGGTCGAGGGATGGCGCTTCCTAGACGCAGTATATTTTGCAGACTATACATTGCTCACCATCGGCGTG
GGTAATTTCTCGCCAAGTACGCATCTCGGCCGGGGTTTGCTTTTCCCATATGCAATCGGAGGAATCATTATCCTT
GGTCTTATCATATCCTCCATCCGTACGCTTATGTTGGAAAATGGCAAGCAAAAGATTGGCAACATGTTGACAGCA
CAAACGCGCAAATACCTACTCAGAGAAGCCTTCTCGGACCGTTCTGGTGCTAAGGGTATTATCCCCTCGCTCGGG
AAGAAGAGTGCCAAAGCGGAAGGCCGCAGCGAGCGGGAGCAGCGCAAACGAGAGTTTATAGCCATGCGTCAGGTA
TGTAAGCTGGCAAACGTCCAACACAAATGGCTCTCGCTCTTGCTTTCTTTTTTGCTTTGGATGACGATATGGCTG
ATCGGAGGTGTCGTTTTCTGGCGCTCGGAGTCGAACGCAAAATGGTCGTACTTTGAGGCTCTATACTTTGCATAT
ACAAGTCTTCTGACAGTTGGTTATGGAGATTTGTATCCGATCAGTAGTTTGGGTAAATCCTTCTTCGTTTTTTGG
TCCCTGCTTGCCGTTCCTACGATTACTATTCTCATCTCCAATATTGGCGATACCGTCATCCGATTTATTCGTGAC
GTTACGCTATTCATTGGCGAGCTCACTATTCTACCGGGTGACCACTCCTTCGTGGACAGGCTTAAGACACTGACT
CACATCTCCTGGGTCAGATGGTGGATGGAGGAAACGACGGGCGAAAAAGAAGGTGCACAACAGCACGCACAATTC
AGCCAAAATCAAGATCCCAATAAAGAGAACGGCAACGACTTCGACTTCAAGAACAACAAGGAAGAAAAGCAAGCC
GAAAACATCCACCAGTACATCTACCTACTCTTCCGAGAGCTACGCAAAATTATTGAGTACGCCAGCAACACTCCA
TCCCGGAAATTCGATTATCTAGAATGGGAATATTATATGAGCCTGATTGAAGGAGATAATAAACCCAAGGTTCTT
GGAGATGAAGCCAATGATGGACAGGCGCAAGCAGCACGGGAATGGAGTTGGACTGATCAGGAGAATCCTTTGCTT
GCCGAAACGAGTGAGGTTCAGTGGCTGCTTGGGCGGTTGACTGAGGTACTTGATCGGGAATTAAGGAGGGCAAGT
CAGGTTCATCATGTATCCGAGAGAGCAAAGGGGGATGGAGCAGAGGATTAG
Transcript >Pro_DTO070G2_2|g8150.t1
ATGAACGAACCTGGTTTCGATGACGCCATTGCCGACGAAGCAGTGGCTCTCGACCGCACCGCCAGCTCTCCAAAT
CAGAAGATAGACGAAATCAATAAGTTGTCGCAACATGATACCGAGTACCAGCAAGCTGCGCGTTGGTGGCTCGCA
AGTACGGCATACCCTCTAGTAGCTGGCACTTTCGGGCCGATGGCTAGCGCTTTCAATATCTGTTCTTTATCACAA
CCATGGCGAATGGACCTCACCAGCAGCGGTGGGACAGATATCCCGGATCCAAAATGGGTCACCGCTATCAACGCA
ATATCACTTGTCTTTGCACTTGTCGCCAACCTAGCCCTCTCGCTTACCATGGCCCGACGCATCCGTTTCGAAATC
GCCCAGCCAATCATCGTCGTAGGGTGGTACATCTCATCGGCGTTCTTGATCGCAATCTTAATTCCCTTCGGCGTG
AACATGTACAAGCCCGAGAACAACGGTCGAATCTACTCGCAGAGTTATTACTATGGCACATTCGCAGCAGGGTTA
TATTTCATCATCGCGTCATTAATGGCAGTGACTGGATATGGTGCCTACCGTGGCTACTCTAGCCGAAAATTCAAT
CTGACTACGAGCCAACGAACACTCATGCTGCAAACTATCATTTTCTGCTTCTATCTTCTGGGCGGTGCAGCCGTC
TACTCTAAGGTCGAGGGATGGCGCTTCCTAGACGCAGTATATTTTGCAGACTATACATTGCTCACCATCGGCGTG
GGTAATTTCTCGCCAAGTACGCATCTCGGCCGGGGTTTGCTTTTCCCATATGCAATCGGAGGAATCATTATCCTT
GGTCTTATCATATCCTCCATCCGTACGCTTATGTTGGAAAATGGCAAGCAAAAGATTGGCAACATGTTGACAGCA
CAAACGCGCAAATACCTACTCAGAGAAGCCTTCTCGGACCGTTCTGGTGCTAAGGGTATTATCCCCTCGCTCGGG
AAGAAGAGTGCCAAAGCGGAAGGCCGCAGCGAGCGGGAGCAGCGCAAACGAGAGTTTATAGCCATGCGTCAGGTA
TGTAAGCTGGCAAACGTCCAACACAAATGGCTCTCGCTCTTGCTTTCTTTTTTGCTTTGGATGACGATATGGCTG
ATCGGAGGTGTCGTTTTCTGGCGCTCGGAGTCGAACGCAAAATGGTCGTACTTTGAGGCTCTATACTTTGCATAT
ACAAGTCTTCTGACAGTTGGTTATGGAGATTTGTATCCGATCAGTAGTTTGGGTAAATCCTTCTTCGTTTTTTGG
TCCCTGCTTGCCGTTCCTACGATTACTATTCTCATCTCCAATATTGGCGATACCGTCATCCGATTTATTCGTGAC
GTTACGCTATTCATTGGCGAGCTCACTATTCTACCGGGTGACCACTCCTTCGTGGACAGGCTTAAGACACTGACT
CACATCTCCTGGGTCAGATGGTGGATGGAGGAAACGACGGGCGAAAAAGAAGGTGCACAACAGCACGCACAATTC
AGCCAAAATCAAGATCCCAATAAAGAGAACGGCAACGACTTCGACTTCAAGAACAACAAGGAAGAAAAGCAAGCC
GAAAACATCCACCAGTACATCTACCTACTCTTCCGAGAGCTACGCAAAATTATTGAGTACGCCAGCAACACTCCA
TCCCGGAAATTCGATTATCTAGAATGGGAATATTATATGAGCCTGATTGAAGGAGATAATAAACCCAAGGTTCTT
GGAGATGAAGCCAATGATGGACAGGCGCAAGCAGCACGGGAATGGAGTTGGACTGATCAGGAGAATCCTTTGCTT
GCCGAAACGAGTGAGGTTCAGTGGCTGCTTGGGCGGTTGACTGAGGTACTTGATCGGGAATTAAGGAGGGCAAGT
CAGGTTCATCATGTATCCGAGAGAGCAAAGGGGGATGGAGCAGAGGATTAG
Gene >Pro_DTO070G2_2|g8150.t1
ATGAACGAACCTGGTTTCGATGACGCCATTGCCGACGAAGCAGTGGCTCTCGACCGCACCGCCAGCTCTCCAAAT
CAGAAGATAGACGAAATCAATAAGTTGTCGCAACATGATACCGAGTACCAGCAAGCTGCGCGTTGGTGGCTCGCA
AGTACGGCATACCCTCTAGTAGCTGTATGCAGAAACCTACTATGTCATCCTTTACTTTGGAAGTCCACATTCTCA
TTATTCTTTTCAGGGCACTTTCGGGCCGATGGCTAGCGCTTTCAATATCTGTTCTTTATCACAACCATGGCGAAT
GGACCTCACCAGCAGCGGTGGGACAGATATCCCGGATCCAAAATGGTAATTAATATGATCAGACATACCCTGAAT
GATTCTCCCGGTAACCTCATATGCGGTTGCAGGGTCACCGCTATCAACGCAATATCACTTGTCTTTGCACTTGTC
GCCAACCTAGCCCTCTCGCTTACCATGGCCCGACGCATCCGTTTCGAAATCGCCCAGCCAATCATCGTCGTAGGG
TGGTACATCTCATCGGCGTTCTTGATCGCAATCTTAATTCCCTTCGGCGTGAACATGTACAAGCCCGAGAACAAC
GGTCGAATCTACTCGCAGAGTTATTACTATGGCACATTCGCAGCAGGGTTATATTTCATCATCGCGTCATTAATG
GCAGTGACTGGATATGGTGCCTACCGTGGCTACTCTAGCCGAAAATTCAATCTGACTACGAGCCAACGAACACTC
ATGCTGCAAACTATCATTTTCTGCTTCTATCTTCTGGGCGGTGCAGCCGTCTACTCTAAGGTCGAGGGATGGCGC
TTCCTAGACGCAGTATATTTTGCAGACTATACATTGCTCACCATCGGCGTGGGTAATTTCTCGCCAAGTACGCAT
CTCGGCCGGGGTTTGCTTTTCCCATATGCAATCGGAGGAATCATTATCCTTGGTCTTATCATATCCTCCATCCGT
ACGCTTATGTTGGAAAATGGCAAGCAAAAGATTGGCAACATGTTGACAGCACAAACGCGCAAATACCTACTCAGA
GAAGCCTTCTCGGACCGTTCTGGTGCTAAGGGTATTATCCCCTCGCTCGGGAAGAAGAGTGCCAAAGCGGAAGGC
CGCAGCGAGCGGGAGCAGCGCAAACGAGAGTTTATAGCCATGCGTCAGGTATGTAAGCTGGCAAACGTCCAACAC
AAATGGCTCTCGCTCTTGCTTTCTTTTTTGCTTTGGATGACGATATGGCTGATCGGAGGTGTCGTTTTCTGGCGC
TCGGAGTCGAACGCAAAATGGTCGTACTTTGAGGCTCTATACTTTGCATATACAAGTCTTCTGACAGTTGGTTAT
GGAGATTTGTATCCGATCAGTAGTTTGGGTAAATCCTTCTTCGTTTTTTGGTCCCTGCTTGCCGTTCCTACGATT
ACTATTCTCATCTCCAATATTGGCGATACCGTCATCCGATTTATTCGTGACGTTACGCTATTCATTGGCGAGCTC
ACTATTCTACCGGGTGACCACTCCTTCGTGGACAGGCTTAAGACACTGACTCACATCTCCTGGGTCAGATGGTGG
ATGGAGGAAACGACGGGCGAAAAAGAAGGTGCACAACAGCACGCACAATTCAGCCAAAATCAAGATCCCAATAAA
GAGAACGGCAACGACTTCGACTTCAAGAACAACAAGGAAGAAAAGCAAGCCGAAAACATCCACCAGTACATCTAC
CTACTCTTCCGAGAGCTACGCAAAATTATTGAGTACGCCAGCAACACTCCATCCCGGAAATTCGATTATCTAGAA
TGGGAATATTATATGAGCCTGATTGAAGGAGATAATAAACCCAAGGTTCTTGGAGATGAAGCCAATGATGGACAG
GCGCAAGCAGCACGGGAATGGAGTTGGACTGATCAGGAGAATCCTTTGCTTGCCGAAACGAGTGAGGTTCAGTGG
CTGCTTGGGCGGTTGACTGAGGTACTTGATCGGGAATTAAGGAGGGCAAGTCAGGTTCATCATGTATCCGAGAGA
GCAAAGGGGGATGGAGCAGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail