Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8053.t1
Gene name
Locationscaffold_16:245877..247260
Strand+
Gene length (bp)1383
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08426 ICE2 ICE2 9.3E-148 5 424

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 34 51 17
3 64 83 19
4 144 166 22
5 173 195 22
6 205 227 22
7 234 251 17
8 271 293 22
9 298 320 22
10 357 379 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8053.t1
MWLLRVFSSALFLAITVSSIPLAFDVGGKTCGLAFSLSLAAFYFLVSLLKVTTPDRSWFRSSIIAVLRFIQWAVI
LVLLIWSLNRFSVDADSTGTGWAERTFSSKRAQDSSLQEWLFGRDGLVETVTLGNWDRLLRWSTPVFQLAEGFCS
LLVIQAAGQITRWLVNRGGRSDSWMIGLLVLSATIISSSVYFLWRVLQFPEISNVDAALIGVSVTCAVILCAWGI
GSGRGNPVESSLLFAYIVLCIYQIFTDYQPSHPVEQISSPSQVGDFPPLPPIIMASYTTLMHALSLLPSIIHAGF
NVITTVFSAVTPSVLISLAYRLLVLYASTRIIPAVRESGARALSQEASIDDTDAAGQVLGFLSYFAPTILIAVYT
SLLMQHFAATSQAMGGSGEWWSTQGNGGGNPWRWINLACTISLYAVELWLGETNDLDNGVAGHWKTD*
Coding >Pro_DTO070G2_2|g8053.t1
ATGTGGCTCCTTCGAGTCTTTTCGTCGGCCTTGTTCCTCGCCATCACCGTCTCCTCCATCCCACTAGCCTTCGAT
GTGGGCGGCAAGACATGTGGCCTAGCCTTCTCACTGTCCTTAGCAGCATTTTACTTCCTGGTCTCGTTGTTGAAG
GTCACCACCCCTGACCGATCGTGGTTCCGTTCCTCCATCATTGCCGTTCTCCGCTTTATACAATGGGCCGTCATC
CTGGTCCTTCTGATTTGGTCGCTGAATCGATTCTCGGTTGATGCCGACAGTACAGGCACAGGATGGGCGGAGCGC
ACTTTCAGCAGCAAAAGGGCGCAGGATTCTTCTCTTCAGGAATGGCTCTTTGGTCGCGACGGCCTGGTGGAAACG
GTGACCCTCGGCAACTGGGATCGACTTCTGAGATGGTCCACCCCGGTTTTCCAACTGGCAGAGGGATTCTGCAGT
TTGTTAGTGATTCAGGCCGCTGGACAAATCACCCGCTGGCTCGTCAACCGAGGTGGACGCAGCGATAGCTGGATG
ATCGGCCTCTTGGTCTTGTCCGCTACGATTATCTCCAGCTCAGTTTACTTCCTTTGGCGTGTTCTGCAATTCCCC
GAAATCTCCAACGTCGATGCGGCCTTGATTGGAGTTTCCGTCACATGCGCCGTCATTCTGTGTGCCTGGGGTATT
GGAAGTGGTCGCGGTAACCCAGTCGAAAGCTCCCTCCTCTTCGCCTATATCGTGCTCTGCATCTACCAGATCTTC
ACCGACTACCAGCCATCGCACCCCGTGGAACAAATATCCTCCCCTTCGCAGGTCGGAGACTTCCCTCCACTGCCT
CCCATCATCATGGCGTCGTACACAACCCTGATGCACGCGCTGTCTCTTCTGCCGTCGATTATTCACGCAGGCTTC
AACGTCATTACCACCGTCTTCAGTGCTGTCACGCCCTCCGTCCTCATCTCACTCGCCTACCGCCTGCTCGTACTG
TATGCATCGACGCGCATCATCCCAGCTGTCCGCGAGTCGGGGGCCCGTGCCCTTTCCCAGGAGGCTTCCATTGAC
GATACCGACGCAGCAGGCCAAGTGCTGGGTTTCCTGAGCTACTTCGCGCCGACAATTCTCATCGCTGTCTACACC
AGTCTCCTCATGCAGCACTTTGCAGCAACCTCACAAGCAATGGGTGGCAGCGGTGAATGGTGGAGCACCCAAGGC
AACGGCGGTGGTAACCCATGGCGGTGGATTAATCTTGCTTGCACAATATCCCTATACGCGGTCGAGCTGTGGCTG
GGGGAAACCAACGATCTCGACAACGGAGTGGCAGGCCACTGGAAAACCGACTGA
Transcript >Pro_DTO070G2_2|g8053.t1
ATGTGGCTCCTTCGAGTCTTTTCGTCGGCCTTGTTCCTCGCCATCACCGTCTCCTCCATCCCACTAGCCTTCGAT
GTGGGCGGCAAGACATGTGGCCTAGCCTTCTCACTGTCCTTAGCAGCATTTTACTTCCTGGTCTCGTTGTTGAAG
GTCACCACCCCTGACCGATCGTGGTTCCGTTCCTCCATCATTGCCGTTCTCCGCTTTATACAATGGGCCGTCATC
CTGGTCCTTCTGATTTGGTCGCTGAATCGATTCTCGGTTGATGCCGACAGTACAGGCACAGGATGGGCGGAGCGC
ACTTTCAGCAGCAAAAGGGCGCAGGATTCTTCTCTTCAGGAATGGCTCTTTGGTCGCGACGGCCTGGTGGAAACG
GTGACCCTCGGCAACTGGGATCGACTTCTGAGATGGTCCACCCCGGTTTTCCAACTGGCAGAGGGATTCTGCAGT
TTGTTAGTGATTCAGGCCGCTGGACAAATCACCCGCTGGCTCGTCAACCGAGGTGGACGCAGCGATAGCTGGATG
ATCGGCCTCTTGGTCTTGTCCGCTACGATTATCTCCAGCTCAGTTTACTTCCTTTGGCGTGTTCTGCAATTCCCC
GAAATCTCCAACGTCGATGCGGCCTTGATTGGAGTTTCCGTCACATGCGCCGTCATTCTGTGTGCCTGGGGTATT
GGAAGTGGTCGCGGTAACCCAGTCGAAAGCTCCCTCCTCTTCGCCTATATCGTGCTCTGCATCTACCAGATCTTC
ACCGACTACCAGCCATCGCACCCCGTGGAACAAATATCCTCCCCTTCGCAGGTCGGAGACTTCCCTCCACTGCCT
CCCATCATCATGGCGTCGTACACAACCCTGATGCACGCGCTGTCTCTTCTGCCGTCGATTATTCACGCAGGCTTC
AACGTCATTACCACCGTCTTCAGTGCTGTCACGCCCTCCGTCCTCATCTCACTCGCCTACCGCCTGCTCGTACTG
TATGCATCGACGCGCATCATCCCAGCTGTCCGCGAGTCGGGGGCCCGTGCCCTTTCCCAGGAGGCTTCCATTGAC
GATACCGACGCAGCAGGCCAAGTGCTGGGTTTCCTGAGCTACTTCGCGCCGACAATTCTCATCGCTGTCTACACC
AGTCTCCTCATGCAGCACTTTGCAGCAACCTCACAAGCAATGGGTGGCAGCGGTGAATGGTGGAGCACCCAAGGC
AACGGCGGTGGTAACCCATGGCGGTGGATTAATCTTGCTTGCACAATATCCCTATACGCGGTCGAGCTGTGGCTG
GGGGAAACCAACGATCTCGACAACGGAGTGGCAGGCCACTGGAAAACCGACTGA
Gene >Pro_DTO070G2_2|g8053.t1
ATGTGGCTCCTTCGAGTCTTTTCGTCGGCCTTGTTCCTCGCCATCACCGTCTCCTCCATCCCACTAGCCTTCGAT
GTGGGCGGCAAGACATGTGGCCTAGCCTTCTCACTGTCCTTAGCAGCATTTTACTTCCTGGTCTCGTTGTTGAAG
GTCACCACCCCTGACCGATCGTGGTTCCGTTCCTCCATCATTGCCGTTCTCCGCTTTATACAATGGGCCGTCATC
CTGGTCCTTCTGATTTGGTCGCTGAATCGATTCTCGGTTGATGCCGACAGTACAGGCACAGGATGGGCGGAGCGC
ACTTTCAGCAGCAAAAGGGCGCAGGATTCTTCTCTTCAGGAATGGCTCTTTGGTCGCGACGGCCTGGTGGAAACG
GTGACCCTCGGCAACTGGGATCGACTTCTGAGATGGTCCACCCCGGTTTTCCAACTGGCAGAGGGATTCTGCAGT
TTGTTAGTGATTCAGGCCGCTGGACAAATCACCCGCTGGCTCGTCAACCGAGGTGGACGCAGCGATAGCTGGATG
GTATGTTTTGATCTCCCCGTGGGTGTCTCGATTAAAAACCAACTCTTATCCTAGATCGGCCTCTTGGTCTTGTCC
GCTACGATTATCTCCAGCTCAGTTTACTTCCTTTGGCGTGTTCTGCAATTCCCCGAAATCTCCAACGTCGATGCG
GCCTTGATTGGAGTTTCCGTCACATGCGCCGTCATTCTGTGTGCCTGGGGTATTGGAAGTGGTCGCGGTAACCCA
GTCGAAAGCTCCCTCCTCTTCGCCTATATCGTGCTCTGCATCTACCAGATCTTCACCGACTACCAGCCATCGCAC
CCCGTGGAACAAATATCCTCCCCTTCGCAGGTCGGAGACTTCCCTCCACTGCCTCCCATCATCATGGCGTCGTAC
ACAACCCTGATGCACGCGCTGTCTCTTCTGCCGTCGATTATTCACGCAGGCTTCAACGTCATTACCACCGTCTTC
AGTGCTGTCACGCCCTCCGTCCTCATCTCACTCGCCTACCGCCTGCTCGTACTGTATGCATCGACGCGCATCATC
CCAGCTGTCCGCGAGTCGGGGGCCCGTGCCCTTTCCCAGGAGGCTTCCATTGACGATACCGACGCAGCAGGCCAA
GTGCTGGGTTTCCTGAGCTACTTCGCGCCGACAATTCTCATCGCTGTCTACACCAGTCTCCTCATGCAGCACTTT
GCAGCAACCTCACAAGCAATGGGTGGCAGCGGTGAATGGTGGAGCACCCAAGGCAACGGCGGTGGTAACCCATGG
CGGTGGATTAATCTTGCTTGCACAATATCCCTATACGCGGTCGAGCTGTGGCTGGGGGAAACCAACGATCTCGAC
AACGGAGTGGCAGGCCACTGGAAAACCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail