Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g8007.t1
Gene name
Locationscaffold_16:135111..137343
Strand+
Gene length (bp)2232
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-26 249 457
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.2E-08 330 553

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 159 181 22
2 201 223 22
3 482 504 22
4 514 536 22
5 541 563 22
6 578 600 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Glyco_tranf_2_3 9.3E-25 249 457

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup7435
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g8136.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g4901.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g5524.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g6216.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g6023.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g5732.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g4088.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g4889.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g7520.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g7180.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g3152.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g8302.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4340.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g5753.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g7338.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g6734.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g8809.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g6765.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g8007.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g7508.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g4913.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g9359.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g6782.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g6887.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g7831.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g5183.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g7369.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g3022.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g7106.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g5929.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g8887.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g9141.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g7890.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g8895.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g8007.t1
MAEESPRKSIVEDVFIPKELLATAKFNSPWELARWEHSLPENSRISLPEPRTSSKRPLSLSSLRVVARPKPATRS
RGRSDPSAFQCTFDYYEESATFEPPSPIPEKEPITPIQNAFLSPQSLSKVSSQTISSEQSSLQEVYEKAKLRGVA
IQRKHWVRLLFQYSIYAFLVLFVYFVLVGMPLWKGAVWWLYYFVRTKFVIQGGYAIIIGLAALYAFCPLMILFEK
DPPALDSESESPDLESNISKVKATALLIPCYKSATIVGATLEAALKIFPKENIFVIANGNDKNPLDNTEEVCKPY
GVNHLWVPIGSKIVAQFVGSYAAKDFENAVLIDDDCLLPPNFPIASDRLKGNVRCIGYTIKSVGPNSSKGTFCQQ
AQDLEYKMSGLQRAFFGKFGSATFPHGAISLWNIEFLKQTFHEHPGFSVSEDWFFGDACRRLGGRITMCSQVFVE
TETPASVFWSGSGGSRGGFGEMTIFQQRFKRWNFFFVVGVYYDLKYILTSWNLGWWEFGAKLCVFQEVYETLIYL
FAPFILPISFIVRPSFCGMLLGITVAMYILNVIIFNEIHLRLKKERIDWNVLLFYYTFYKIALTVVNVFSCYWSL
YKYARYFAQRHPKVIEDRDAVEVLLSLEKHSGSRISVEDDVIPVDGVLGRGVARKLTITKVQAGKRRMTVGSEKG
GWI*
Coding >Pro_DTO070G2_2|g8007.t1
ATGGCTGAAGAAAGCCCTAGAAAATCCATCGTGGAAGATGTGTTCATTCCCAAAGAACTACTTGCGACTGCCAAA
TTCAACTCGCCGTGGGAATTGGCTCGATGGGAACATTCTCTCCCCGAAAACAGTCGTATATCACTTCCGGAGCCT
CGCACCTCTTCCAAACGTCCTCTGAGTCTTTCTTCTCTGCGAGTAGTGGCAAGACCAAAGCCTGCAACTCGGTCT
CGTGGACGCAGTGATCCTTCTGCTTTTCAGTGTACATTCGACTACTATGAAGAGTCCGCCACATTCGAGCCTCCC
TCTCCGATCCCCGAGAAAGAACCAATAACTCCAATTCAGAATGCATTCCTCAGTCCCCAATCACTCAGCAAAGTC
AGCTCTCAGACAATCAGCAGCGAGCAGAGCAGCCTGCAAGAAGTCTATGAAAAAGCCAAATTGAGAGGCGTTGCT
ATCCAACGAAAGCATTGGGTGCGGCTATTGTTTCAATATAGCATTTATGCTTTCCTCGTTCTGTTCGTCTACTTT
GTCCTCGTCGGTATGCCACTGTGGAAAGGTGCTGTCTGGTGGCTGTATTATTTTGTCCGAACCAAGTTCGTTATC
CAAGGCGGATACGCAATTATCATTGGTCTGGCTGCATTATACGCATTCTGTCCTCTGATGATCCTCTTCGAGAAG
GATCCTCCAGCCCTAGATTCCGAATCCGAATCTCCAGACCTGGAAAGTAATATCTCCAAGGTAAAAGCAACTGCT
CTCCTCATTCCTTGCTATAAATCAGCAACAATCGTCGGCGCAACACTCGAAGCCGCCTTGAAAATCTTCCCCAAA
GAGAACATCTTCGTCATAGCAAACGGCAACGACAAAAACCCCCTCGATAACACAGAAGAAGTCTGCAAACCCTAC
GGTGTAAACCACCTCTGGGTACCTATCGGCTCAAAGATCGTGGCGCAGTTCGTCGGCAGCTACGCAGCCAAAGAC
TTTGAAAATGCCGTCCTAATCGACGACGACTGTCTCCTTCCCCCAAACTTCCCAATCGCCAGCGACAGACTAAAA
GGCAACGTCCGATGCATTGGATACACAATTAAAAGTGTCGGCCCCAATTCTTCAAAGGGAACGTTCTGCCAACAA
GCCCAAGACCTCGAGTACAAAATGTCCGGTCTCCAACGTGCTTTCTTCGGGAAATTCGGAAGTGCTACATTCCCA
CACGGAGCCATCTCGCTCTGGAATATCGAGTTCTTAAAACAGACCTTCCATGAACATCCCGGCTTCTCCGTGTCG
GAGGATTGGTTCTTCGGTGATGCGTGCCGGCGTCTGGGTGGACGTATTACGATGTGCTCGCAGGTCTTCGTCGAA
ACAGAGACGCCGGCTTCGGTGTTCTGGAGTGGTTCTGGTGGTAGTCGTGGTGGATTCGGCGAGATGACTATCTTC
CAACAGCGGTTTAAGCGTTGGAATTTCTTCTTCGTTGTTGGCGTGTACTATGATTTGAAATATATCTTGACTAGC
TGGAACCTGGGTTGGTGGGAGTTTGGTGCAAAGTTGTGCGTTTTTCAAGAGGTCTATGAAACCCTCATCTACCTC
TTTGCCCCCTTCATCCTCCCAATCTCATTTATAGTCCGTCCCTCATTCTGCGGAATGCTACTGGGTATTACGGTC
GCGATGTACATCCTCAACGTCATAATCTTCAACGAGATTCACCTCCGACTAAAGAAGGAGCGCATTGACTGGAAC
GTCTTGTTGTTCTACTATACGTTCTACAAGATCGCGTTGACGGTGGTCAACGTGTTCAGCTGCTACTGGTCACTG
TACAAGTACGCGCGGTACTTTGCGCAGCGGCATCCGAAGGTCATTGAGGACCGGGATGCGGTCGAGGTGTTACTT
AGCCTTGAGAAGCATTCGGGTTCGAGGATTTCGGTTGAGGATGATGTTATTCCAGTTGATGGTGTGCTAGGGAGG
GGCGTTGCGAGGAAGTTGACGATAACGAAGGTTCAGGCTGGAAAGAGGAGGATGACGGTGGGATCTGAGAAGGGT
GGATGGATTTGA
Transcript >Pro_DTO070G2_2|g8007.t1
ATGGCTGAAGAAAGCCCTAGAAAATCCATCGTGGAAGATGTGTTCATTCCCAAAGAACTACTTGCGACTGCCAAA
TTCAACTCGCCGTGGGAATTGGCTCGATGGGAACATTCTCTCCCCGAAAACAGTCGTATATCACTTCCGGAGCCT
CGCACCTCTTCCAAACGTCCTCTGAGTCTTTCTTCTCTGCGAGTAGTGGCAAGACCAAAGCCTGCAACTCGGTCT
CGTGGACGCAGTGATCCTTCTGCTTTTCAGTGTACATTCGACTACTATGAAGAGTCCGCCACATTCGAGCCTCCC
TCTCCGATCCCCGAGAAAGAACCAATAACTCCAATTCAGAATGCATTCCTCAGTCCCCAATCACTCAGCAAAGTC
AGCTCTCAGACAATCAGCAGCGAGCAGAGCAGCCTGCAAGAAGTCTATGAAAAAGCCAAATTGAGAGGCGTTGCT
ATCCAACGAAAGCATTGGGTGCGGCTATTGTTTCAATATAGCATTTATGCTTTCCTCGTTCTGTTCGTCTACTTT
GTCCTCGTCGGTATGCCACTGTGGAAAGGTGCTGTCTGGTGGCTGTATTATTTTGTCCGAACCAAGTTCGTTATC
CAAGGCGGATACGCAATTATCATTGGTCTGGCTGCATTATACGCATTCTGTCCTCTGATGATCCTCTTCGAGAAG
GATCCTCCAGCCCTAGATTCCGAATCCGAATCTCCAGACCTGGAAAGTAATATCTCCAAGGTAAAAGCAACTGCT
CTCCTCATTCCTTGCTATAAATCAGCAACAATCGTCGGCGCAACACTCGAAGCCGCCTTGAAAATCTTCCCCAAA
GAGAACATCTTCGTCATAGCAAACGGCAACGACAAAAACCCCCTCGATAACACAGAAGAAGTCTGCAAACCCTAC
GGTGTAAACCACCTCTGGGTACCTATCGGCTCAAAGATCGTGGCGCAGTTCGTCGGCAGCTACGCAGCCAAAGAC
TTTGAAAATGCCGTCCTAATCGACGACGACTGTCTCCTTCCCCCAAACTTCCCAATCGCCAGCGACAGACTAAAA
GGCAACGTCCGATGCATTGGATACACAATTAAAAGTGTCGGCCCCAATTCTTCAAAGGGAACGTTCTGCCAACAA
GCCCAAGACCTCGAGTACAAAATGTCCGGTCTCCAACGTGCTTTCTTCGGGAAATTCGGAAGTGCTACATTCCCA
CACGGAGCCATCTCGCTCTGGAATATCGAGTTCTTAAAACAGACCTTCCATGAACATCCCGGCTTCTCCGTGTCG
GAGGATTGGTTCTTCGGTGATGCGTGCCGGCGTCTGGGTGGACGTATTACGATGTGCTCGCAGGTCTTCGTCGAA
ACAGAGACGCCGGCTTCGGTGTTCTGGAGTGGTTCTGGTGGTAGTCGTGGTGGATTCGGCGAGATGACTATCTTC
CAACAGCGGTTTAAGCGTTGGAATTTCTTCTTCGTTGTTGGCGTGTACTATGATTTGAAATATATCTTGACTAGC
TGGAACCTGGGTTGGTGGGAGTTTGGTGCAAAGTTGTGCGTTTTTCAAGAGGTCTATGAAACCCTCATCTACCTC
TTTGCCCCCTTCATCCTCCCAATCTCATTTATAGTCCGTCCCTCATTCTGCGGAATGCTACTGGGTATTACGGTC
GCGATGTACATCCTCAACGTCATAATCTTCAACGAGATTCACCTCCGACTAAAGAAGGAGCGCATTGACTGGAAC
GTCTTGTTGTTCTACTATACGTTCTACAAGATCGCGTTGACGGTGGTCAACGTGTTCAGCTGCTACTGGTCACTG
TACAAGTACGCGCGGTACTTTGCGCAGCGGCATCCGAAGGTCATTGAGGACCGGGATGCGGTCGAGGTGTTACTT
AGCCTTGAGAAGCATTCGGGTTCGAGGATTTCGGTTGAGGATGATGTTATTCCAGTTGATGGTGTGCTAGGGAGG
GGCGTTGCGAGGAAGTTGACGATAACGAAGGTTCAGGCTGGAAAGAGGAGGATGACGGTGGGATCTGAGAAGGGT
GGATGGATTTGA
Gene >Pro_DTO070G2_2|g8007.t1
ATGGCTGAAGAAAGCCCTAGAAAATCCATCGTGGAAGATGTGTTCATTCCCAAAGAACTACTTGCGACTGCCAAA
TTCAACTCGCCGTGGGAATTGGCTCGATGGGAACATTCTCTCCCCGAAAACAGTCGTATATCACTTCCGGAGCCT
CGCACCTCTTCCAAACGTCCTCTGAGTCTTTCTTCTCTGCGAGTAGTGGCAAGACCAAAGCCTGCAACTCGGTCT
CGTGGACGCAGTGATCCTTCTGCTTTTCAGTGTATGAAATTGATATCCTATTTCTATGGCAAAGACTTGTAGAAA
TACATGAGAGATGATGATAATCTTATATCTCAATACTGATCCTTTCTCGTTCTTCAGGTACATTCGACTACTATG
AAGAGTCCGCCACATTCGAGCCTCCCTCTCCGATCCCCGAGAAAGAACCAATAACTCCAATTCAGAATGCATTCC
TCAGTCCCCAATCACTCAGCAAAGTCAGCTCTCAGACAATCAGCAGCGAGCAGAGCAGCCTGCAAGAAGTCTATG
AAAAAGCCAAATTGAGAGGCGTTGCTATCCAACGAAAGCATTGGGTGCGGCTATTGTTTCAATATAGCATTTATG
CTTTCCTCGTTCTGTTCGTCTACTTTGTCCTCGTCGGTATGCCACTGTGGAAAGGTGCTGTCTGGTGGCTGTATT
ATTTTGTCCGAACCAAGTTCGTTATCCAAGGCGGATACGCAATTATCATTGGTCTGGCTGCATTGTAAGTGTTTT
CTCGAGTCGCCAAGTTTCTTGCCCTAACAAACTAGATACGCATTCTGTCCTCTGATGATCCTCTTCGAGAAGGAT
CCTCCAGCCCTAGATTCCGAATCCGAATCTCCAGACCTGGAAAGTAATATCTCCAAGGTAAAAGCAACTGCTCTC
CTCATTCCTTGCTATAAATCAGCAACAATCGTCGGCGCAACACTCGAAGCCGCCTTGAAAATCTTCCCCAAAGAG
AACATCTTCGTCATAGCAAACGGCAACGACAAAAACCCCCTCGATAACACAGAAGAAGTCTGCAAACCCTACGGT
GTAAACCACCTCTGGGTACCTATCGGCTCAAAGATCGTGGCGCAGTTCGTCGGCAGCTACGCAGCCAAAGACTTT
GAAAATGCCGTCCTAATCGACGACGACTGTCTCCTTCCCCCAAACTTCCCAATCGCCAGCGACAGACTAAAAGGC
AACGTCCGATGCATTGGATACACAATTAAAAGTGTCGGCCCCAATTCTTCAAAGGGAACGTTCTGCCAACAAGCC
CAAGACCTCGAGTACAAAATGTCCGGTCTCCAACGTGCTTTCTTCGGGAAATTCGGAAGTGCTACATTCCCACAC
GGAGCCATCTCGCTCTGGAATATCGAGTTCTTAAAACAGACCTTCCATGAACATCCCGGCTTCTCCGTGTCGGAG
GATTGGTTCTTCGGTGATGCGTGCCGGCGTCTGGGTGGACGTATTACGATGTGCTCGCAGGTCTTCGTCGAAACA
GAGACGCCGGCTTCGGTGTTCTGGAGTGGTTCTGGTGGTAGTCGTGGTGGATTCGGCGAGATGACTATCTTCCAA
CAGCGGTTTAAGCGTTGGAATTTCTTCTTCGTTGTTGGCGTGTACTATGATTTGAAATATATCTTGACTAGCTGG
AACCTGGGTTGGTGGGAGTTTGGTGCAAAGTTGTGCGTTTTTCAAGAGGTATGACAGGCACATCCATCCATCTAG
GATATAAGCTAACCATGACAGGTCTATGAAACCCTCATCTACCTCTTTGCCCCCTTCATCCTCCCAATCTCATTT
ATAGTCCGTCCCTCATTCTGCGGAATGCTACTGGGTATTACGGTCGCGATGTACATCCTCAACGTCATAATCTTC
AACGAGATTCACCTCCGACTAAAGAAGGAGCGCATTGACTGGAACGTCTTGTTGTTCTACTATACGTTCTACAAG
ATCGCGTTGACGGTGGTCAACGTGTTCAGCTGCTACTGGTCACTGTACAAGTACGCGCGGTACTTTGCGCAGCGG
CATCCGAAGGTCATTGAGGACCGGGATGCGGTCGAGGTGTTACTTAGCCTTGAGAAGCATTCGGGTTCGAGGATT
TCGGTTGAGGATGATGTTATTCCAGTTGATGGTGTGCTAGGGAGGGGCGTTGCGAGGAAGTTGACGATAACGAAG
GTTCAGGCTGGAAAGAGGAGGATGACGGTGGGATCTGAGAAGGGTGGATGGATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail