Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7994.t1
Gene name
Locationscaffold_16:97022..101065
Strand-
Gene length (bp)4043
Transcript length (bp)2358
Coding sequence length (bp)2358
Protein length (aa) 786

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.8E-08 228 332

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 356 375 19
2 396 418 22
3 452 474 22
4 481 503 22
5 548 570 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7994.t1
MSFLTRLASLLGLSSSAPVAPPGAALAATVTVPASLGFVPVAIHFDLFNILVGHGGPATADEVSATCNARIKARG
GDEPELSTRLASDTLYIMAGLGLVERVAEDCFTANAITNHMVAMPSAQHGALHFTTEGLMAGAFLMKKLRDTQFA
YPFAEADGPLQYAYQLMGQSELAKQHTYSIMEAQGRMDSFNHFMVGKFLKFGTFPERVKSMGYDLDGALAGDTTT
GTLAGSATMVDIGGGRGELLLEVQAVYPHLGVDDLIVQEFNADIDDVPGVRLMEWNYKNEAEQPVRGACVYALQH
ILHNLPDLDAVALLQKISRAMTPGSRVLIIEYAKNLTYTALHASMIAIEGDVDIGTGTFQACWVLTSIVGVALLF
RYAIKIWVRWALPQVTAPGRIWGTEDLFFLVAWGFDITHMVLIQMSANSGLGRHFFYLTGEERLYAMKWDFLSQP
MAVTSAMVSRAGMMWFLLTCFAASDKKIRQSIIVCAVVQVVVNMVTIVQIIVQCGPNPYQTTDRVQYFHYMWTPL
PEDGSVKCQSPVVQTTVGFVQGGFNTVIDFFLAVLAAVELWQFFLRTLHRNPNTSFWSQFRKINGTVRSRRIWQT
ITLSGPLLLSGCASIVKTYKLKSLGDRQDFTYNIVTFVLWVKIENYSILLASCAPVARLFLRSFIDHRREGRYHG
YWSRSRSTAHNEPDTEMKRRVNVQDQWLDSATVTNMTNTYIKDEEDHWNGHGHERSVSQISKAEMPDHHDDGCVT
IKTDIVVQVDDGRSISSGGTRLLPNGGESHFGGFH*
Coding >Pro_DTO070G2_2|g7994.t1
ATGTCCTTCCTCACCCGCTTGGCCAGCCTACTGGGCTTGTCATCTTCGGCCCCCGTTGCACCCCCAGGCGCCGCA
CTCGCAGCAACCGTCACAGTACCTGCATCGTTGGGATTTGTCCCGGTCGCGATTCACTTTGATCTCTTCAATATC
CTCGTGGGTCACGGGGGACCTGCGACGGCCGACGAAGTCTCGGCTACCTGCAATGCACGCATCAAAGCCCGAGGG
GGAGATGAACCCGAGCTGAGTACCAGATTAGCCTCGGACACACTCTACATTATGGCCGGACTCGGCCTAGTTGAA
CGCGTGGCCGAGGACTGCTTCACAGCAAATGCCATCACAAACCACATGGTCGCCATGCCTTCCGCCCAGCATGGC
GCACTGCACTTCACCACCGAGGGTCTAATGGCCGGCGCATTTTTGATGAAAAAGCTCCGAGACACCCAATTCGCA
TACCCTTTTGCTGAAGCAGACGGCCCCTTGCAATACGCCTATCAGCTAATGGGTCAGTCTGAGCTGGCAAAGCAG
CACACGTACTCAATTATGGAGGCTCAGGGTCGCATGGATAGTTTCAACCATTTCATGGTCGGCAAGTTCCTGAAG
TTCGGAACATTCCCCGAGCGCGTCAAATCGATGGGCTATGATCTAGATGGTGCTTTGGCAGGTGACACTACCACT
GGCACCCTCGCTGGCTCCGCTACTATGGTCGACATCGGCGGCGGTCGTGGCGAACTCCTCCTTGAGGTTCAGGCC
GTATATCCGCATCTCGGTGTGGATGATCTAATCGTGCAGGAGTTCAATGCGGATATCGATGATGTGCCTGGTGTG
CGTCTTATGGAGTGGAATTACAAAAATGAGGCTGAGCAGCCCGTTCGGGGTGCGTGTGTTTACGCGCTGCAACAT
ATCTTGCATAATTTGCCTGATTTGGATGCTGTAGCGTTGCTGCAGAAGATTTCGCGTGCTATGACACCTGGTTCG
CGAGTTTTGATTATTGAGTACGCCAAGAATTTGACTTATACTGCGCTTCATGCGAGTATGATTGCGATTGAGGGC
GATGTTGATATCGGAACCGGCACATTTCAGGCTTGCTGGGTCCTCACATCCATTGTCGGCGTAGCATTGTTGTTC
CGCTATGCTATCAAGATCTGGGTGCGTTGGGCTTTACCGCAGGTCACTGCACCTGGTCGAATTTGGGGTACAGAG
GACTTATTCTTCCTCGTGGCTTGGGGTTTTGATATCACTCATATGGTACTTATTCAAATGAGTGCCAACTCGGGC
CTTGGGAGACATTTCTTCTACTTAACTGGGGAAGAGCGTCTTTATGCTATGAAATGGGACTTTCTTTCACAGCCG
ATGGCTGTCACTTCGGCAATGGTGTCACGCGCAGGCATGATGTGGTTTCTTTTGACTTGCTTTGCAGCCAGCGAC
AAGAAGATTCGACAATCTATTATCGTCTGCGCCGTTGTTCAGGTTGTCGTCAATATGGTTACAATCGTCCAGATT
ATTGTCCAGTGCGGACCGAACCCGTATCAAACGACTGATCGAGTACAATACTTTCACTATATGTGGACACCACTC
CCTGAAGATGGTTCCGTCAAGTGCCAATCACCGGTTGTCCAAACGACTGTAGGCTTTGTACAAGGAGGATTCAAC
ACCGTGATCGATTTCTTCCTTGCCGTGCTTGCTGCAGTCGAACTCTGGCAATTCTTCCTGCGAACCCTCCACCGT
AATCCAAACACCTCATTCTGGTCTCAATTCCGCAAAATTAATGGCACCGTTCGATCCCGCCGGATCTGGCAGACC
ATCACGCTCAGTGGACCACTCTTGCTCTCTGGCTGTGCTTCTATTGTAAAGACCTATAAACTCAAATCGCTTGGT
GACAGACAAGACTTCACCTATAATATCGTGACGTTCGTTCTCTGGGTAAAGATTGAGAACTACAGCATCCTCCTC
GCCTCCTGTGCCCCAGTAGCCCGCCTCTTCCTCCGGTCCTTCATTGACCACAGACGCGAGGGCCGGTATCACGGC
TACTGGTCTCGCTCTCGGTCAACCGCACATAATGAGCCAGACACAGAGATGAAGCGCCGCGTTAATGTTCAGGAC
CAGTGGCTGGATTCGGCTACAGTGACTAATATGACCAATACTTATATTAAGGATGAGGAGGATCACTGGAATGGA
CATGGGCATGAGCGCTCTGTCAGTCAGATTTCGAAGGCGGAGATGCCGGACCATCATGATGATGGATGTGTTACT
ATTAAGACAGATATTGTTGTTCAAGTTGATGATGGGAGGTCGATCTCTTCGGGTGGGACGAGGTTGTTGCCTAAT
GGGGGTGAATCTCATTTTGGGGGATTTCATTGA
Transcript >Pro_DTO070G2_2|g7994.t1
ATGTCCTTCCTCACCCGCTTGGCCAGCCTACTGGGCTTGTCATCTTCGGCCCCCGTTGCACCCCCAGGCGCCGCA
CTCGCAGCAACCGTCACAGTACCTGCATCGTTGGGATTTGTCCCGGTCGCGATTCACTTTGATCTCTTCAATATC
CTCGTGGGTCACGGGGGACCTGCGACGGCCGACGAAGTCTCGGCTACCTGCAATGCACGCATCAAAGCCCGAGGG
GGAGATGAACCCGAGCTGAGTACCAGATTAGCCTCGGACACACTCTACATTATGGCCGGACTCGGCCTAGTTGAA
CGCGTGGCCGAGGACTGCTTCACAGCAAATGCCATCACAAACCACATGGTCGCCATGCCTTCCGCCCAGCATGGC
GCACTGCACTTCACCACCGAGGGTCTAATGGCCGGCGCATTTTTGATGAAAAAGCTCCGAGACACCCAATTCGCA
TACCCTTTTGCTGAAGCAGACGGCCCCTTGCAATACGCCTATCAGCTAATGGGTCAGTCTGAGCTGGCAAAGCAG
CACACGTACTCAATTATGGAGGCTCAGGGTCGCATGGATAGTTTCAACCATTTCATGGTCGGCAAGTTCCTGAAG
TTCGGAACATTCCCCGAGCGCGTCAAATCGATGGGCTATGATCTAGATGGTGCTTTGGCAGGTGACACTACCACT
GGCACCCTCGCTGGCTCCGCTACTATGGTCGACATCGGCGGCGGTCGTGGCGAACTCCTCCTTGAGGTTCAGGCC
GTATATCCGCATCTCGGTGTGGATGATCTAATCGTGCAGGAGTTCAATGCGGATATCGATGATGTGCCTGGTGTG
CGTCTTATGGAGTGGAATTACAAAAATGAGGCTGAGCAGCCCGTTCGGGGTGCGTGTGTTTACGCGCTGCAACAT
ATCTTGCATAATTTGCCTGATTTGGATGCTGTAGCGTTGCTGCAGAAGATTTCGCGTGCTATGACACCTGGTTCG
CGAGTTTTGATTATTGAGTACGCCAAGAATTTGACTTATACTGCGCTTCATGCGAGTATGATTGCGATTGAGGGC
GATGTTGATATCGGAACCGGCACATTTCAGGCTTGCTGGGTCCTCACATCCATTGTCGGCGTAGCATTGTTGTTC
CGCTATGCTATCAAGATCTGGGTGCGTTGGGCTTTACCGCAGGTCACTGCACCTGGTCGAATTTGGGGTACAGAG
GACTTATTCTTCCTCGTGGCTTGGGGTTTTGATATCACTCATATGGTACTTATTCAAATGAGTGCCAACTCGGGC
CTTGGGAGACATTTCTTCTACTTAACTGGGGAAGAGCGTCTTTATGCTATGAAATGGGACTTTCTTTCACAGCCG
ATGGCTGTCACTTCGGCAATGGTGTCACGCGCAGGCATGATGTGGTTTCTTTTGACTTGCTTTGCAGCCAGCGAC
AAGAAGATTCGACAATCTATTATCGTCTGCGCCGTTGTTCAGGTTGTCGTCAATATGGTTACAATCGTCCAGATT
ATTGTCCAGTGCGGACCGAACCCGTATCAAACGACTGATCGAGTACAATACTTTCACTATATGTGGACACCACTC
CCTGAAGATGGTTCCGTCAAGTGCCAATCACCGGTTGTCCAAACGACTGTAGGCTTTGTACAAGGAGGATTCAAC
ACCGTGATCGATTTCTTCCTTGCCGTGCTTGCTGCAGTCGAACTCTGGCAATTCTTCCTGCGAACCCTCCACCGT
AATCCAAACACCTCATTCTGGTCTCAATTCCGCAAAATTAATGGCACCGTTCGATCCCGCCGGATCTGGCAGACC
ATCACGCTCAGTGGACCACTCTTGCTCTCTGGCTGTGCTTCTATTGTAAAGACCTATAAACTCAAATCGCTTGGT
GACAGACAAGACTTCACCTATAATATCGTGACGTTCGTTCTCTGGGTAAAGATTGAGAACTACAGCATCCTCCTC
GCCTCCTGTGCCCCAGTAGCCCGCCTCTTCCTCCGGTCCTTCATTGACCACAGACGCGAGGGCCGGTATCACGGC
TACTGGTCTCGCTCTCGGTCAACCGCACATAATGAGCCAGACACAGAGATGAAGCGCCGCGTTAATGTTCAGGAC
CAGTGGCTGGATTCGGCTACAGTGACTAATATGACCAATACTTATATTAAGGATGAGGAGGATCACTGGAATGGA
CATGGGCATGAGCGCTCTGTCAGTCAGATTTCGAAGGCGGAGATGCCGGACCATCATGATGATGGATGTGTTACT
ATTAAGACAGATATTGTTGTTCAAGTTGATGATGGGAGGTCGATCTCTTCGGGTGGGACGAGGTTGTTGCCTAAT
GGGGGTGAATCTCATTTTGGGGGATTTCATTGA
Gene >Pro_DTO070G2_2|g7994.t1
ATGTCCTTCCTCACCCGCTTGGCCAGCCTACTGGGCTTGTCATCTTCGGCCCCCGTTGCACCCCCAGGCGCCGCA
CTCGCAGCAACCGTCACAGTAGTGAGTCTGATGAATCTGTCAGATAATTCTTCTATCTAATTCAGTTACAGCCTG
CATCGTTGGGATTTGTCCCGGTCGCGATTCACTTTGATCTCTTCAATATCCTCGTGGGTCACGGGGGACCTGCGA
CGGCCGACGAAGTCTCGGCTACCTGCAATGCACGCATCAAAGCCCGAGGGGGAGATGAACCCGAGCTGAGTACGT
GTTCCAGTTTGAATGGATAATGGCTTGTTATCATGGCTGTTGTGGATGTTATGCTGACAATGGATATAGGTACCA
GATTAGCCTGTAAGCACACCCTTGTACAGGTATAGGTACAAGCAGTATCCCAATGATATGCTAATGCATTCCTGC
AGCGGACACACTCTACATTATGGCCGGACTCGGCCTAGTTGAACGCGTGGCCGAGGACTGCTTCACAGCAAATGC
CATCACAAACCACATGGTCGCCATGCCTTCCGCCCAGCATGGCGCACTGCACTTGTCAGTTCCCCCATGCATGTC
CTGTTTCTATGATGAGATCAATATAACCAGCCAAGCACGCACTAACCCCATCCAGCACCACCGAGGGTCTAATGG
CCGGCGCATTTTTGATGAAAAAGCTCCGAGACACCCAATTCGCATACCCTTTTGCTGAAGCAGACGGCCCCTTGC
AATACGCCTATCAGCTAATGGGTCAGTCTGAGCTGGCAAAGCAGCACACGTACTCAATTATGGAGGCTCAGGGTC
GCATGGATAGTTTCAACCATTTCATGGTCGGCAAGTTCCTGAAGTTCGGAACATTCCCCGAGCGCGTCAAATCGA
TGGGCTATGATCTAGATGGTGCTTTGGCAGGTGACACTACCACTGGCACCCTCGCTGGCTCCGCTACTATGGTCG
ACATCGGCGGCGGTCGTGGCGAACTCCTCCTTGAGGTTCAGGCCGTATATCCGCATCTCGGTGTGGATGATCTAA
TCGTGCAGGAGTTCAATGCGGATATCGATGATGTGCCTGGTGTGCGTCTTATGGAGTGGAATTACAAAAATGAGG
CTGAGCAGCCCGTTCGGGGTGCGTGTGTTTACGCGCTGCAACATATCTTGCATAATTTGCCTGATTTGGATGCTG
TAGCGTTGCTGCAGAAGATTTCGCGTGCTATGACACCTGGTTCGCGAGTTTTGATTATTGAGTACGCCAAGAATT
TGACTTATACTGCGCTTCATGCGAGTATGATTGCGATGTATGGGGGGCGAGAAAGGAGTTCGGTGGAGTGGAGGC
AGGTGGCGGGGTTGTGTGGGCTAGAGGTGACTTTTGAGGTTTATGTTAGGGCTGGCGAGTCATTGGTGGAGATGA
GGAGGGCGGATCGGTAGTTCAGGGTTGAGCGATATAATTCACTGGTTAATTCAATTGGTTAATGGTTGGTTGTTG
ATACTAGTTCATTGTTAATCGTTCTTTGTCAATATGATATATCATTTCTTGATGTATACTCATCACATCCCTTCA
ATCAATAGTTTCGCTTACGTGCATATAGTTTTTATCTCTCGAACTCAGCAGATCTTTGCAGATCCGATCTAGGGG
TGTATCGAATCCATCAATCCCATGTGGATGTGTATTTGATGTATTTCTTTTTCTCATTCTTCGTCACATCCCTTA
CTGCATCTCACATGGCCATTGCATGATTTCCATCCCTCTCCGGAATGTCGCCTGTGCTTGATCCACATGGTCCTG
GCAATGCGAAGTGTCCATTGCCACGATCAAAAGGATGGGATATTTTCTGACACGCAGATTGGCCACACGAGCTTA
ACTCCTGTCATAAGTCAAAACTGGACGTTTCTGACCCCGTACATCAAGGTTCAATACTCTGCCATATCATACAAC
TCGCTTCGCTTGACCCGATTATATTTTCAGTGTAAATCAAGGGATTTGCCCTACATCCCTTGTTTCCTCTCGATC
ATTTTACGTATATGCGCCCTTCCACCCGTTGGAAACGAGTCTAGACAAGTTTCTGACCTGTAAACCGGTTCGCGC
GAGACTTTTGACAGGATCTCCATTTCTAATAACCTTTAAAGGCAACTTAAAAGCTCTCCTCTACTATCCCTTGGT
GCTGGATTGGATTTGGTTTATATTCTTTCGCATTTGATCCATCTGACCGACCCCGCGCATCGTTCTCGTCTCGTA
TATATGCCAATGAGTATTTGAATTGGATCCCTGCCTATAACCGAGAGGTCTGGTTATTGTGTTTTATCTTCATTA
TGGATATTCCGAAACCTAGTGAGGGCGATGTTGATATCGGTATGTTTACCTGGCAAATGCCAAGCAAATGGACCT
AGAGGATCGTGGATTGACATGTTTAACAGGAACCGGCACATTTCAGGCTTGCTGGGTATGATCTTGATCTTATAA
ATTGCCTCTGGATATATGTATACTAATCCTCGAGCAGGTCCTCACATCCATTGTCGGCGTAGCATTGTTGTTCCG
CTATGCTATCAAGATCTGGGTGCGTTGGGCTTTACCGCAGGTCACTGCACCTGGTCGAATTTGGGGTACAGAGGA
CTTATTCTTCCTCGTGGCTTGGGGTTTTGATATCACTCATATGGTACTTATTCAAATGAGGTGAGGTCGACTAGT
GTCATTCCTCCCAGGTCAGCCATTAACTCTGTCTAGTGCCAACTCGGGCCTTGGGAGACATTTCTTCTACTTAAC
TGGGGAAGAGCGTCTTTATGCTATGAAATGGGACTTTCTTTCACAGCCGATGGCTGTCACTTCGGCAATGGTGTC
ACGCGCAGGCATGATGTGGTTTCTTTTGACTTGCTTTGCAGCCAGCGACAAGAAGATTCGACAATCTATTATCGT
CTGCGCCGTTGTTCAGGTTGTCGTCAATATGGTTACAATCGTCCAGATTATTGTCCAGTGCGGACCGAACCCGTA
TCAAACGGTTAGTATCCTCCTTCTTAGTGCTTGGTCCATTCTAATCTCAGAGCAGACTGATCGAGTACAATACTT
TCACTATATGTGGACACCACTCCCTGAAGATGGTTCCGTCAAGTGCCAATCACCGGTTGTCCAAACGACTGTAGG
CTTTGTACAAGGAGGTATGGAAAATTATATACTTCAGCAGCTCAGCTCAAAGCTAATTGCAATTCGCACAGGATT
CAACACCGTGATCGATTTCTTCCTTGCCGTGCTTGCTGCAGTCGAACTCTGGCAATTCTTCCTGCGAACCCTCCA
CCGTAATCCAAACACCTCATTCTGGTCTCAATTCCGCAAAATTAATGGCACCGTTCGATCCCGCCGGATCTGGCA
GACCATCACGCTCAGTGGACCACTCTTGCTCTCTGGCTGTGCTTCTATTGTAAAGACCTATGTGAGTATAATATC
TTTTCTCGACTTACACAGCAGCGCTAATATCATTCACTAGAAACTCAAATCGCTTGGTGACAGACAAGACTTCAC
CTATAATATCGTGACGTTCGTTCTCTGGGTAAAGTAAGTACAACTACCATCTCCCAATCCCAGTATTATTAACCA
ACACTCCCAGGATTGAGAACTACAGCATCCTCCTCGCCTCCTGTGCCCCAGTAGCCCGCCTCTTCCTCCGGTCCT
TCATTGACCACAGACGCGAGGGCCGGTATCACGGCTACTGGTCTCGCTCTCGGTCAACCGCACATAATGAGCCAG
ACACAGAGATGAAGCGCCGCGTTAATGTTCAGGACCAGTGGCTGGATTCGGCTACAGTGACTAATATGACCAATA
CTTATATTAAGGATGAGGAGGATCACTGGAATGGACATGGGCATGAGCGCTCTGTCAGTCAGATTTCGAAGGCGG
AGATGCCGGACCATCATGATGATGGATGTGTTACTATTAAGACAGATATTGTTGTTCAAGTTGATGATGGGAGGT
CGATCTCTTCGGGTGGGACGAGGTTGTTGCCTAATGGGGGTGAATCTCATTTTGGGGGATTTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail