Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7984.t1
Gene name
Locationscaffold_16:72220..74531
Strand+
Gene length (bp)2311
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 9.6E-49 44 236
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 2.5E-44 250 436
PF00686 CBM_20 Starch binding domain 4.5E-30 510 603

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0005488 binding No
GO:0030246 carbohydrate binding No
GO:0003674 molecular_function No
GO:0030247 polysaccharide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7984.t1
MMASHFWAALWVLTLGYAVVVAPQILVPRATGSLDAWLVSETAVAKQGILDNIGSAGAYAATAKPGIVVASPSTS
DPDYYYTWTRDSALVFKTLVDMFKNGDSGLLNIIEEYIDAQAYIQTVSNPSGDLSGGSGLGEPKFNVDETAFTDS
WGRPQRDGPALRATALVSFGQWLIDNGYTTYATNIVWPVVRNDLSYVAQYWNQTGFDLWEEVSGSSFFTVAAQHR
ALVEGSTFASQSFWTGSYILANFGGGRSGKDANTLLATIQTFDPEAGCDDTTFQPCSARALANHKVVTDSFRAIY
PVNSGIAAGKAVSVGRYPEDTYYNGNPWYLCTLAAAEQLYDAIYTWNRIGSLTITSVSLGFFQDLYSSAATGTYS
SSSDTYTSILSAVTAYADGYLSNVEQYAASNGSLFEQFSKSDGSQLSARDLTWSYAALLTANDRRNAIVPAPWGE
TSASSIPGQCQYTSDVGTFSSATNTAWPTTLTSRSGSGTTTTTSAKTTSTTAPCTTPTAVAVTFNVIATTVYGQN
IKLAGSISELGSWSPSSAIALSSSLYTTSNPLWFVTVTLPVGTGFTYKYIQVASDGTITWESDPNLSYTVPTTCG
TTAVTISDTWSTMIMIVYLSWYGDAAVTS*
Coding >Pro_DTO070G2_2|g7984.t1
ATGATGGCTTCTCACTTTTGGGCTGCTCTTTGGGTGCTCACACTTGGCTACGCTGTTGTAGTTGCACCACAGATA
TTGGTCCCTCGTGCGACTGGCAGTCTGGACGCCTGGTTGGTGTCTGAGACAGCAGTGGCAAAACAGGGTATCCTC
GATAACATTGGATCTGCTGGTGCCTATGCTGCGACTGCAAAGCCTGGCATTGTAGTCGCCAGCCCGAGTACCTCT
GACCCTGACTACTACTATACTTGGACTCGTGACTCGGCTCTGGTGTTCAAAACTCTGGTCGATATGTTCAAGAAC
GGTGACAGCGGCTTGTTAAATATTATTGAAGAATACATCGATGCACAGGCCTATATCCAGACGGTATCCAATCCA
TCTGGAGATCTTTCTGGTGGCAGTGGATTGGGGGAGCCTAAGTTCAACGTCGACGAGACAGCCTTCACTGACTCT
TGGGGTCGTCCTCAGCGTGATGGACCGGCCTTGCGAGCCACTGCATTGGTCTCGTTTGGCCAATGGCTCATTGAT
AATGGGTACACCACTTACGCGACCAACATTGTCTGGCCCGTTGTGCGCAACGATCTCTCCTATGTTGCCCAATAC
TGGAATCAGACTGGATTTGATCTCTGGGAAGAAGTTTCTGGCTCATCGTTCTTTACTGTCGCAGCTCAGCATCGC
GCCTTGGTGGAGGGAAGCACATTCGCAAGCCAGTCTTTCTGGACTGGGTCTTATATCCTGGCCAACTTTGGTGGT
GGCCGCTCTGGAAAAGATGCCAACACGCTACTCGCCACCATCCAAACTTTCGACCCAGAGGCCGGATGCGATGAC
ACCACATTCCAGCCTTGCTCAGCTAGAGCACTCGCAAATCACAAAGTTGTGACTGATTCATTCCGGGCGATCTAT
CCTGTCAACTCTGGTATTGCTGCGGGCAAGGCTGTTTCTGTTGGTCGATACCCGGAGGACACATATTACAATGGT
AACCCTTGGTACCTATGCACATTGGCTGCGGCTGAGCAGTTGTACGATGCGATATATACGTGGAATCGTATCGGT
TCTTTGACAATCACCTCTGTCTCTCTCGGCTTCTTCCAGGATCTGTACAGCTCCGCTGCGACCGGTACCTACTCC
TCGTCCAGTGATACATACACCTCGATTCTGAGCGCTGTCACGGCATATGCGGATGGATATCTCAGTAATGTGGAA
CAATACGCTGCATCGAATGGCTCCTTGTTTGAGCAATTCTCCAAGTCAGATGGCTCACAACTCTCGGCTCGTGAC
CTGACTTGGTCCTACGCAGCCCTGCTTACTGCCAATGACCGTCGGAATGCGATAGTTCCTGCACCATGGGGTGAG
ACATCTGCCAGCAGTATACCTGGCCAATGCCAGTACACTTCGGATGTTGGGACTTTCAGCAGTGCAACAAACACC
GCCTGGCCGACCACGTTGACTAGTAGATCAGGCAGCGGAACTACTACCACTACGTCTGCGAAGACAACCTCGACT
ACAGCACCATGCACTACTCCAACAGCCGTTGCAGTGACATTCAACGTGATTGCCACTACTGTATATGGCCAGAAC
ATCAAGCTTGCTGGATCTATCTCCGAGCTTGGCTCCTGGTCCCCAAGCAGTGCTATTGCGCTGAGCTCTTCTTTG
TACACTACGAGCAACCCTTTGTGGTTTGTGACTGTGACACTTCCGGTGGGCACTGGGTTTACCTACAAGTATATC
CAGGTGGCGAGTGATGGCACTATTACATGGGAGAGTGACCCGAACCTGTCATACACCGTTCCCACCACGTGTGGT
ACCACAGCTGTCACGATTAGTGATACCTGGAGCACCATGATAATGATTGTTTATCTGAGCTGGTACGGTGATGCG
GCCGTCACATCATAA
Transcript >Pro_DTO070G2_2|g7984.t1
ATGATGGCTTCTCACTTTTGGGCTGCTCTTTGGGTGCTCACACTTGGCTACGCTGTTGTAGTTGCACCACAGATA
TTGGTCCCTCGTGCGACTGGCAGTCTGGACGCCTGGTTGGTGTCTGAGACAGCAGTGGCAAAACAGGGTATCCTC
GATAACATTGGATCTGCTGGTGCCTATGCTGCGACTGCAAAGCCTGGCATTGTAGTCGCCAGCCCGAGTACCTCT
GACCCTGACTACTACTATACTTGGACTCGTGACTCGGCTCTGGTGTTCAAAACTCTGGTCGATATGTTCAAGAAC
GGTGACAGCGGCTTGTTAAATATTATTGAAGAATACATCGATGCACAGGCCTATATCCAGACGGTATCCAATCCA
TCTGGAGATCTTTCTGGTGGCAGTGGATTGGGGGAGCCTAAGTTCAACGTCGACGAGACAGCCTTCACTGACTCT
TGGGGTCGTCCTCAGCGTGATGGACCGGCCTTGCGAGCCACTGCATTGGTCTCGTTTGGCCAATGGCTCATTGAT
AATGGGTACACCACTTACGCGACCAACATTGTCTGGCCCGTTGTGCGCAACGATCTCTCCTATGTTGCCCAATAC
TGGAATCAGACTGGATTTGATCTCTGGGAAGAAGTTTCTGGCTCATCGTTCTTTACTGTCGCAGCTCAGCATCGC
GCCTTGGTGGAGGGAAGCACATTCGCAAGCCAGTCTTTCTGGACTGGGTCTTATATCCTGGCCAACTTTGGTGGT
GGCCGCTCTGGAAAAGATGCCAACACGCTACTCGCCACCATCCAAACTTTCGACCCAGAGGCCGGATGCGATGAC
ACCACATTCCAGCCTTGCTCAGCTAGAGCACTCGCAAATCACAAAGTTGTGACTGATTCATTCCGGGCGATCTAT
CCTGTCAACTCTGGTATTGCTGCGGGCAAGGCTGTTTCTGTTGGTCGATACCCGGAGGACACATATTACAATGGT
AACCCTTGGTACCTATGCACATTGGCTGCGGCTGAGCAGTTGTACGATGCGATATATACGTGGAATCGTATCGGT
TCTTTGACAATCACCTCTGTCTCTCTCGGCTTCTTCCAGGATCTGTACAGCTCCGCTGCGACCGGTACCTACTCC
TCGTCCAGTGATACATACACCTCGATTCTGAGCGCTGTCACGGCATATGCGGATGGATATCTCAGTAATGTGGAA
CAATACGCTGCATCGAATGGCTCCTTGTTTGAGCAATTCTCCAAGTCAGATGGCTCACAACTCTCGGCTCGTGAC
CTGACTTGGTCCTACGCAGCCCTGCTTACTGCCAATGACCGTCGGAATGCGATAGTTCCTGCACCATGGGGTGAG
ACATCTGCCAGCAGTATACCTGGCCAATGCCAGTACACTTCGGATGTTGGGACTTTCAGCAGTGCAACAAACACC
GCCTGGCCGACCACGTTGACTAGTAGATCAGGCAGCGGAACTACTACCACTACGTCTGCGAAGACAACCTCGACT
ACAGCACCATGCACTACTCCAACAGCCGTTGCAGTGACATTCAACGTGATTGCCACTACTGTATATGGCCAGAAC
ATCAAGCTTGCTGGATCTATCTCCGAGCTTGGCTCCTGGTCCCCAAGCAGTGCTATTGCGCTGAGCTCTTCTTTG
TACACTACGAGCAACCCTTTGTGGTTTGTGACTGTGACACTTCCGGTGGGCACTGGGTTTACCTACAAGTATATC
CAGGTGGCGAGTGATGGCACTATTACATGGGAGAGTGACCCGAACCTGTCATACACCGTTCCCACCACGTGTGGT
ACCACAGCTGTCACGATTAGTGATACCTGGAGCACCATGATAATGATTGTTTATCTGAGCTGGTACGGTGATGCG
GCCGTCACATCATAA
Gene >Pro_DTO070G2_2|g7984.t1
ATGATGGCTTCTCACTTTTGGGCTGCTCTTTGGGTGCTCACACTTGGCTACGCTGTTGTAGTTGCACCACAGATA
TTGGTCCCTCGTGCGACTGGCAGTCTGGACGCCTGGTTGGTGTCTGAGACAGCAGTGGCAAAACAGGGTATCCTC
GATAACATTGGATCTGCTGGTGCCTATGCTGCGACTGCAAAGCCTGGCATTGTAGTCGCCAGCCCGAGTACCTCT
GACCCTGACTGTAAGTATTGGATAGCTATTTGTGGCAGCGGAAAACTAACTTAACTGGCCTACAGACTACTATAC
TTGGACTCGTGACTCGGCTCTGGTGTTCAAAACTCTGGTCGATATGTTCAAGAACGGTGACAGCGGCTTGTTAAA
TATTATTGAAGAATACATCGATGCACAGGCCTATATCCAGACGGTATCCAATCCATCTGGAGATCTTTCTGGTGG
CAGTGGATTGGGGGAGCCTAAGTTCAACGTCGACGAGACAGCCTTCACTGACTCTTGGGGTCGTCCTCAGCGTGA
TGGACCGGCCTTGCGAGCCACTGCATTGGTCTCGTTTGGCCAATGGCTCATTGTATAAACCCCGAATCTGTTGGC
TTTTGCATTGCTAACCCATTTAGGATAATGGGTACACCACTTACGCGACCAACATTGTCTGGCCCGTTGTGCGCA
ACGATCTCTCCTATGTTGCCCAATACTGGAATCAGACTGGATTTGGTTATTACACCTCAAATTTTAGTTGCGCAC
ATTTCTAATGCCCTATAGATCTCTGGGAAGAAGTTTCTGGCTCATCGTTCTTTACTGTCGCAGCTCAGCATCGCG
CCTTGGTGGAGGGAAGCACATTCGCAAGCCAGGTTGGTTCCTCGTGTTCGTACTGTGACTCTCAGGCTCCACAGG
TCTTGTGCTTCTTACAGTCTTTCTGGACTGGGTCTTATATCCTGGCCAACTTTGGTGGTGGCCGCTCTGGAAAAG
ATGCCAACACGCTACTCGCCACCATCCAAACTTTCGACCCAGAGGCCGGATGCGATGACACCACATTCCAGCCTT
GCTCAGCTAGAGCACTCGCAAATCACAAAGTTGTGACTGATTCATTCCGGGCGATCTATCCTGTCAACTCTGGTA
TTGCTGCGGGCAAGGCTGTTTCTGTTGGTCGATACCCGGAGGACACATATTACAATGGTAACCCTTGGTACCTAT
GCACATTGGCTGCGGCTGAGCAGTTGTACGATGCGATATATACGTGGAATCGTATCGGTTCTTTGACAATCACCT
CTGTCTCTCTCGGCTTCTTCCAGGATCTGTACAGCTCCGCTGCGACCGGTACCTACTCCTCGTCCAGTGATACAT
ACACCTCGATTCTGAGCGCTGTCACGGCATATGCGGATGGATATCTCAGTAATGTGGTATGTTGCATGCTATCGA
CTATTGACCACCTCAACTGACAGATATCCTAGGAACAATACGCTGCATCGAATGGCTCCTTGTTTGAGCAATTCT
CCAAGTCAGATGGCTCACAACTCTCGGCTCGTGACCTGACTTGGTCCTACGCAGCCCTGCTTACTGCCAATGACC
GTCGGAATGCGATAGTTCCTGCACCATGGGGTGAGACATCTGCCAGCAGTATACCTGGCCAATGCCAGTACACTT
CGGATGTTGGGACTTTCAGCAGTGCAACAAACACCGCCTGGCCGACCACGTTGACTAGTAGATCAGGCAGCGGAA
CTACTACCACTACGTCTGCGAAGACAACCTCGACTACAGCACCATGCACTACTCCAACAGCCGTTGCAGTGACAT
TCAACGTGATTGCCACTACTGTATATGGCCAGAACATCAAGCTTGCTGGATCTATCTCCGAGCTTGGCTCCTGGT
CCCCAAGCAGTGCTATTGCGCTGAGCTCTTCTTTGTACACTACGAGCAACCCTTTGTGGTTTGTGACTGTGACAC
TTCCGGTGGGCACTGGGTTTACCTACAAGTATATCCAGGTGGCGAGTGATGGCACTATTACATGGGAGAGTGACC
CGAACCTGTCATACACCGTTCCCACCACGTGTGGTACCACAGCTGTCACGATTAGTGATACCTGGAGGTGATAAC
TGAAGTTTTGGATACCTCAATTGAAGATTGTGCATGCTTTATTCTTCTATCGTCGTAGAATAGCACCATGATAAT
GATTGTTTATCTGAGTATTAGCTGTCCGAACACAACCACCGCCTGTCCATTGTGTAGGCGCTGCCGTTTGAACTA
TTACCTGATCGGGCTAACCTTACCGATAGGCTGGTACGGTGATGCGGCCGTCACATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail