Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7955.t1
Gene name
Locationscaffold_15:508182..510818
Strand+
Gene length (bp)2636
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.3E-22 266 384
PF08022 FAD_binding_8 FAD-binding domain 2.9E-13 435 536
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 1.6E-11 547 728

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 152 169 17
3 222 244 22
4 303 325 22
5 340 362 22
6 369 391 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7955.t1
MSPFFLVVSLWQATLVTASALCATGCQTAVSSNEFSGISILEDYYSALCQNSLQVKATFICMRDYCPEDEIAKGW
NDLNQVCEQDGGVELLPWSIIDDVTDAETKSWPILTYEDIQLGSTFNTSVSVDQSLFQLAYQTTFDWDDQTTRRT
NYGYATIGFWGLIVLFGALDNLFRYLNNLSVLRSRTMTRFESSVRRLVVVPPILKKSPFTRFCGIPSTSRLQAMT
ISAFFVINIILMCVEYRAFENNLYFTRKSSQLWRYIADRAAVMAISNLPVMWLFSTRNNCLLWATSWEFGTFNTF
HRWIGRACAIEVFVHGMGVCIYQYQEVGKEFFLPLWKERDFYMGVVAALSIIVTCLLASSGIRRAAYELFLIVHQ
AFAVLILAALWYHLTVDGPDHVPYLWPCIAVWSFDRLGRVFRLLIWNKPTSHSSGEYNSDADLIQVKARIRRVVA
PQPGSYFYVYGWRSLYFWESHPFTLSGWTTVNTEEESYTELVFLIGVHGGFTSRLRKQLLRQDESGIDSSSSVRK
VHLAVEGPYGPHFDPWNSEMAVFVIGGAGITIATSFIQQLVDFVRLGKHVDQKIKCLKIIWAIKNIELYRFVYER
YISTWEAVFASTYIEISLDVYLTSPSKADQQVELPIPESQTGHSATKKKIRAVVSPVCSMNFHASEEKVASEEVH
NQSAFGPLKTNLIHGRPIIRDVIRSQVESFNSYPEQQIALIGCGPDTMAHDIRLSFAESSKETDVNIIFHLAPFG
W*
Coding >Pro_DTO070G2_2|g7955.t1
ATGAGCCCCTTCTTCCTGGTAGTCAGCCTGTGGCAAGCCACGTTGGTAACAGCAAGCGCTCTATGTGCGACTGGC
TGTCAGACTGCGGTTTCCAGCAACGAATTTTCAGGCATCAGCATCCTTGAGGACTATTATTCAGCTTTGTGCCAA
AACTCCCTCCAAGTGAAGGCAACATTCATTTGTATGCGAGACTACTGCCCAGAAGACGAAATTGCAAAAGGATGG
AATGATCTCAATCAGGTGTGTGAACAAGATGGAGGAGTTGAGCTTCTTCCATGGTCTATCATTGACGATGTGACG
GACGCGGAGACAAAATCTTGGCCTATCTTGACCTATGAGGATATCCAACTTGGCTCTACCTTTAACACCTCAGTT
TCCGTGGATCAGAGCCTCTTCCAACTTGCGTATCAGACAACTTTCGACTGGGATGATCAAACTACGCGGCGAACG
AACTACGGATATGCTACAATTGGATTCTGGGGATTGATAGTACTTTTTGGTGCCCTTGACAATCTTTTCCGATAT
TTAAACAATTTGTCTGTGCTGCGCTCGAGAACAATGACAAGATTCGAAAGCTCCGTTCGCCGACTGGTAGTCGTG
CCACCGATCTTGAAGAAAAGTCCATTCACGCGCTTTTGCGGAATTCCTTCTACATCAAGACTACAAGCCATGACT
ATCTCGGCGTTCTTCGTGATCAACATAATCCTCATGTGTGTGGAATACCGTGCTTTCGAAAATAATCTTTACTTC
ACCCGAAAGTCCTCACAGCTTTGGCGTTATATAGCAGATAGGGCGGCGGTCATGGCGATCAGCAATTTACCAGTC
ATGTGGCTCTTTTCCACAAGAAACAATTGTCTTTTGTGGGCAACATCCTGGGAATTTGGGACCTTTAATACCTTT
CACCGTTGGATTGGAAGAGCTTGTGCTATAGAGGTATTTGTCCATGGGATGGGGGTTTGTATCTATCAATATCAA
GAGGTTGGAAAGGAGTTTTTCTTACCTCTCTGGAAAGAGCGTGACTTCTATATGGGAGTTGTTGCAGCTCTCTCG
ATTATCGTGACGTGCCTTTTAGCAAGCTCGGGAATCCGAAGGGCAGCCTATGAATTATTTTTGATAGTTCACCAG
GCTTTTGCTGTTCTTATTCTTGCTGCGTTGTGGTACCATCTAACTGTCGATGGCCCAGATCATGTCCCATACCTT
TGGCCTTGTATTGCTGTTTGGTCATTTGATAGACTGGGAAGGGTGTTTCGTCTATTGATCTGGAACAAGCCAACT
TCACACTCCTCTGGAGAATACAACAGTGACGCAGATCTCATTCAGGTAAAGGCCCGCATACGACGAGTTGTTGCT
CCTCAACCTGGAAGTTACTTCTATGTGTATGGGTGGCGGTCTCTTTATTTTTGGGAAAGTCACCCATTTACACTT
AGCGGGTGGACTACGGTCAATACGGAAGAAGAATCTTACACAGAACTCGTATTTCTTATTGGAGTCCACGGAGGC
TTCACATCCAGGCTTCGCAAACAGCTGCTTCGTCAAGATGAGTCCGGGATCGACTCTTCATCCTCTGTGAGAAAG
GTTCACCTGGCTGTTGAAGGTCCTTATGGTCCACATTTCGATCCGTGGAATTCTGAAATGGCCGTTTTTGTCATT
GGTGGCGCGGGTATCACGATCGCAACGTCTTTCATCCAACAGCTGGTAGATTTCGTGCGGCTTGGCAAGCACGTG
GATCAAAAGATCAAGTGCTTGAAGATAATATGGGCCATAAAGAACATCGAGCTTTATCGGTTCGTCTATGAGCGC
TATATATCAACGTGGGAAGCTGTCTTCGCATCAACATATATTGAAATCTCACTGGACGTGTACCTGACAAGCCCT
TCCAAGGCGGATCAACAAGTTGAATTGCCGATCCCAGAATCTCAAACCGGACACAGTGCGACAAAAAAGAAAATA
CGAGCAGTTGTATCGCCGGTGTGTTCAATGAACTTTCATGCCTCGGAGGAAAAAGTGGCTTCTGAAGAGGTACAT
AACCAGTCAGCGTTTGGGCCTCTAAAAACAAATCTCATTCACGGAAGGCCAATCATCCGCGATGTGATTAGAAGC
CAAGTTGAAAGCTTCAATTCTTACCCGGAGCAACAGATTGCACTGATCGGCTGTGGACCGGATACAATGGCACAC
GACATACGCCTTTCCTTTGCAGAATCCTCAAAAGAGACTGACGTCAACATTATCTTTCACCTGGCCCCTTTCGGC
TGGTGA
Transcript >Pro_DTO070G2_2|g7955.t1
ATGAGCCCCTTCTTCCTGGTAGTCAGCCTGTGGCAAGCCACGTTGGTAACAGCAAGCGCTCTATGTGCGACTGGC
TGTCAGACTGCGGTTTCCAGCAACGAATTTTCAGGCATCAGCATCCTTGAGGACTATTATTCAGCTTTGTGCCAA
AACTCCCTCCAAGTGAAGGCAACATTCATTTGTATGCGAGACTACTGCCCAGAAGACGAAATTGCAAAAGGATGG
AATGATCTCAATCAGGTGTGTGAACAAGATGGAGGAGTTGAGCTTCTTCCATGGTCTATCATTGACGATGTGACG
GACGCGGAGACAAAATCTTGGCCTATCTTGACCTATGAGGATATCCAACTTGGCTCTACCTTTAACACCTCAGTT
TCCGTGGATCAGAGCCTCTTCCAACTTGCGTATCAGACAACTTTCGACTGGGATGATCAAACTACGCGGCGAACG
AACTACGGATATGCTACAATTGGATTCTGGGGATTGATAGTACTTTTTGGTGCCCTTGACAATCTTTTCCGATAT
TTAAACAATTTGTCTGTGCTGCGCTCGAGAACAATGACAAGATTCGAAAGCTCCGTTCGCCGACTGGTAGTCGTG
CCACCGATCTTGAAGAAAAGTCCATTCACGCGCTTTTGCGGAATTCCTTCTACATCAAGACTACAAGCCATGACT
ATCTCGGCGTTCTTCGTGATCAACATAATCCTCATGTGTGTGGAATACCGTGCTTTCGAAAATAATCTTTACTTC
ACCCGAAAGTCCTCACAGCTTTGGCGTTATATAGCAGATAGGGCGGCGGTCATGGCGATCAGCAATTTACCAGTC
ATGTGGCTCTTTTCCACAAGAAACAATTGTCTTTTGTGGGCAACATCCTGGGAATTTGGGACCTTTAATACCTTT
CACCGTTGGATTGGAAGAGCTTGTGCTATAGAGGTATTTGTCCATGGGATGGGGGTTTGTATCTATCAATATCAA
GAGGTTGGAAAGGAGTTTTTCTTACCTCTCTGGAAAGAGCGTGACTTCTATATGGGAGTTGTTGCAGCTCTCTCG
ATTATCGTGACGTGCCTTTTAGCAAGCTCGGGAATCCGAAGGGCAGCCTATGAATTATTTTTGATAGTTCACCAG
GCTTTTGCTGTTCTTATTCTTGCTGCGTTGTGGTACCATCTAACTGTCGATGGCCCAGATCATGTCCCATACCTT
TGGCCTTGTATTGCTGTTTGGTCATTTGATAGACTGGGAAGGGTGTTTCGTCTATTGATCTGGAACAAGCCAACT
TCACACTCCTCTGGAGAATACAACAGTGACGCAGATCTCATTCAGGTAAAGGCCCGCATACGACGAGTTGTTGCT
CCTCAACCTGGAAGTTACTTCTATGTGTATGGGTGGCGGTCTCTTTATTTTTGGGAAAGTCACCCATTTACACTT
AGCGGGTGGACTACGGTCAATACGGAAGAAGAATCTTACACAGAACTCGTATTTCTTATTGGAGTCCACGGAGGC
TTCACATCCAGGCTTCGCAAACAGCTGCTTCGTCAAGATGAGTCCGGGATCGACTCTTCATCCTCTGTGAGAAAG
GTTCACCTGGCTGTTGAAGGTCCTTATGGTCCACATTTCGATCCGTGGAATTCTGAAATGGCCGTTTTTGTCATT
GGTGGCGCGGGTATCACGATCGCAACGTCTTTCATCCAACAGCTGGTAGATTTCGTGCGGCTTGGCAAGCACGTG
GATCAAAAGATCAAGTGCTTGAAGATAATATGGGCCATAAAGAACATCGAGCTTTATCGGTTCGTCTATGAGCGC
TATATATCAACGTGGGAAGCTGTCTTCGCATCAACATATATTGAAATCTCACTGGACGTGTACCTGACAAGCCCT
TCCAAGGCGGATCAACAAGTTGAATTGCCGATCCCAGAATCTCAAACCGGACACAGTGCGACAAAAAAGAAAATA
CGAGCAGTTGTATCGCCGGTGTGTTCAATGAACTTTCATGCCTCGGAGGAAAAAGTGGCTTCTGAAGAGGTACAT
AACCAGTCAGCGTTTGGGCCTCTAAAAACAAATCTCATTCACGGAAGGCCAATCATCCGCGATGTGATTAGAAGC
CAAGTTGAAAGCTTCAATTCTTACCCGGAGCAACAGATTGCACTGATCGGCTGTGGACCGGATACAATGGCACAC
GACATACGCCTTTCCTTTGCAGAATCCTCAAAAGAGACTGACGTCAACATTATCTTTCACCTGGCCCCTTTCGGC
TGGTGA
Gene >Pro_DTO070G2_2|g7955.t1
ATGAGCCCCTTCTTCCTGGTAGTCAGCCTGTGGCAAGCCACGTTGGTAACAGCAAGCGCTCTATGTGCGACTGGC
TGTCAGACTGCGGTTTCCAGCAACGAATTTTCAGGCATCAGCATCCTTGAGGACTATTATTCAGCTTTGTGCCAA
AACTCCCTCCAAGTGAAGGCAACATTCATTTGTATGCGAGACTACTGCCCAGAAGACGAAATTGCAAAAGGATGG
AATGATCTCAATCAGGTGTGTGAACAAGATGGAGGAGTTGAGCTTCTTCCATGGTCTATCATTGACGATGTGACG
GACGCGGAGACAAAATCTTGGCCTATCTTGACCTATGAGGATATCCAACTTGGCTCTACCTTTAACACCTCAGTT
TCCGTGGATCAGAGCCTCTTCCAACTTGCGTATCAGACAACTGTGAGTTATACTATATCACTGGATCTGATTGAT
GATTAACTGGTGTCTAGTTCGACTGGGATGATCAAACTACGCGGCGAACGAACTACGGGTAACTCATAGATCCAC
CCACTCCCTTGGTTTTTACAATTACTTACGCACATACCTTCCTCATAGATATGCTACAATTGGATTCTGGGGATT
GATAGTACTTTTTGGTGCCCTTGACAATCTTTTCCGATATTTAAACAATTTGTCTGTGCTGCGCTCGAGAACAAT
GACAAGATTCGAAAGCTCCGTTCGCCGACTGGTAGTCGTGCCACCGATCTTGAAGAAAAGTCCATTCACGCGCTT
TTGCGGAATTCCTTCTACATCAAGACTACAAGCCATGACTATCTCGGCGTTCTTCGTGATCAACATAATCCTCAT
GTGTGTGGAATACCGTGCTTTCGAAAATAATCTTTAGTGAGACCAGATTTTATCCTCCTCCTGATTGGCCAACCG
GATAATGAGTTGACTGACCTCCCTTCCCATAGCTTCACCCGAAAGTCCTCACAGCTTTGGCGTTATATAGCAGAT
AGGGCGGCGGTCATGGCGATCAGCAATTTACCAGTCATGTGGCTCTTTTCCACAAGAAACAATTGTCTTTTGTGG
GCAACATCCTGGGAATTTGGGACCTTTAATACCTTTCACCGTTGGATTGGAAGAGCTTGTGCTATAGAGGTATTT
GTCCATGGGATGGGGGTTTGTATCTATCAATATCAAGGTGTGTCTATTCGCATTTTTTTTCGCAGGAGGCCTTTG
AGAAAATATTCCCGAGTTGGATTGAAGTTGACAAAGTTTGAGAATGAAGAGGTTGGAAAGGAGTTTTTCTTACCT
CTCTGGAAAGAGCGTGACTTCTATATGGGAGTTGTTGTAAGTCAAAAATTCCGTGTATTCTCTGCCTTAGCTAAT
ACGCTCTCACAGGCAGCTCTCTCGATTATCGTGACGTGCCTTTTAGCAAGCTCGGGAATCCGAAGGGCAGCCTAT
GAATTATTTTTGATAGTTCACCAGGCTTTTGCTGTTCTTATTCTTGCTGCGTTGTGGTAGTGAGTTCCTTTCAGC
ATCAACTTTTAGGAACATGCTTGACTAACGGAATTTCCAGCCATCTAACTGTCGATGGCCCAGATCATGTCCCAT
ACCTTTGGCCTTGTATTGCTGTTTGGTCATTTGATAGACTGGGAAGGGTGTTTCGTCTATTGATCTGGAACAAGC
CAACTTCACACTCCTCTGGAGAATACAACAGTGACGCAGATCTCATTCAGGTAAAGGCCCGCATACGACGAGTTG
TTGCTCCTCAACCTGGAAGTTACTTCTATGTGTATGGGTGGCGGTCTCTTTATTTTTGGGAAAGTCACCCATTTA
CACTTAGCGGGTGGACTACGGTCAATACGGAAGAAGAATCTTACACAGAACTCGTATTTCTTATTGGAGTCCACG
GAGGCTTCACATCCAGGCTTCGCAAACAGCTGCTTCGTCAAGATGAGTCCGGGATCGACTCTTCATCCTCTGTGA
GAAAGGTTCACCTGGCTGTTGAAGGTCCTTATGGTCCACATTTCGATCCGTGGAATTCTGAAATGGCCGTTTTTG
TCATTGGTGGCGCGGGTATCACGATCGCAACGTCTTTCATCCAACAGCTGGTAGATTTCGTGCGGCTTGGCAAGC
ACGTGGATCAAAAGATCAAGTGCTTGAAGATAATATGGGCCATAAAGAACATCGAGCTTTATCGGTTCGTCTATG
AGCGCTATATATCAACGTGGGAAGCTGTCTTCGCATCAACATATATTGAAATCTCACTGGACGTGTACCTGACAA
GCCCTTCCAAGGCGGATCAACAAGTTGAATTGCCGATCCCAGAATCTCAAACCGGACACAGTGCGACAAAAAAGA
AAATACGAGCAGTTGTATCGCCGGTGTGTTCAATGAACTTTCATGCCTCGGAGGAAAAAGTGGCTTCTGAAGAGG
TACATAACCAGTCAGCGTTTGGGCCTCTAAAAACAAATCTCATTCACGGAAGGCCAATCATCCGCGATGTGATTA
GAAGCCAAGTTGAAAGCTTCAATTCTTACCCGGAGCAACAGATTGCACTGATCGGCTGTGGACCGGATACAATGG
CACACGACATACGCCTTTCCTTTGCAGAATCCTCAAAAGAGACTGACGTCAACATTATCTTTCACCTGGCCCCTT
TCGGCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail