Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7805.t1
Gene name
Locationscaffold_15:120757..126183
Strand-
Gene length (bp)5426
Transcript length (bp)5130
Coding sequence length (bp)5130
Protein length (aa) 1710

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08429 PLU-1 PLU-1-like protein 4.3E-104 917 1261
PF02373 JmjC JmjC domain, hydroxylase 1.9E-42 623 739
PF01388 ARID ARID/BRIGHT DNA binding domain 7.5E-21 141 225
PF02375 JmjN jmjN domain 1.4E-17 72 105
PF00628 PHD PHD-finger 4.7E-09 451 496
PF00628 PHD PHD-finger 6.2E-07 1318 1363
PF02928 zf-C5HC2 C5HC2 zinc finger 1.1E-12 845 904

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7805.t1
MGAPASAGATSTAAASQPTRSSSTHPSHSHNVPLSARRSTPLDLSTVERRGQPNNPREPSKRIRPHGIPEAPTFR
PTEEEFKDPVAYIQKIAPEGKKYGICRVVPPEGWQPTFAIDTERFHFKTRRQELNSVEGGNRANMNYVDGLAMFH
KQHGTNYSRLPSVDKRPLDLYKLKKAVESRGGFESVCKTKKWAEIGRDLGYSGKIMSSLSTSLKNSYQRYLQPYE
EYLARAKPGVQQQLELEHGGPYTPSPLQSPMTHKPMLDENGTPSKIRDDTPSLPRMAASHTPMAFTPVAHSPMAH
TPMEKSPEKPTPPIEPTPPPASRPAPTSFTPVNSGLGGFTAVNHSPFTPVNNGPPIKREGENGTLTPKVVSEHGF
VSTPVNGQDEESLKRGISREASSQCENGDDDDGSGRRSKRLKKDSLPTVAGSHMSLLRPAPVKSRKDGSQPAGEK
CETCGKSDDQGIILVCDGCELGYHKACLDPSTTTPSEHDWHCPKCLVGTGEFGFEDGGVYSLKQFQEKANEFKKK
YFASKMPFDPVLNTHRRETEDDVEAEFWKLVVDLHETVEVEYGADIHSTTHGSGFPTIERNPLDPFSSDPWNLNV
LPFYGDSLFRYIKSDISGMTVPWVYVGMCFSTFCWHNEDHYAYSANYQHFGATKTWYGIPGADAEAFEAAMRDAV
PELFEGQPDLLFQLVTLMPPDKLRKAGVNVYALDQRAGQFVLTFPQAYHAGFNHGFNFNEAVNFAPADWEPYGAA
GVDRLQNFRRHPCFSHDELLLTAAARDTTIATAKWLAPALARTCARELRDRAAFLYRQKEISARTPGFGPDSMAD
DVQPRFVVENEDLSEDDYQCQHCKAYAYLTQFRCHKSGKTVCLSHVDTYDCCGETLAQKLCGSGHTVRYRMGDEE
LQSLVQKVQERARIPEAWSEKLDKTLEDEPKPQLKALHNLLNEGEKIPYHLPGLQDLAAFVQRCDKWVEEANNYI
TRKQQNRKKNEKAWRRGSTKASQLDDRDREVRRIEHIYALQAEADKLSFDCPQMAVLEEKTREIEKFQQDINNAL
MHPHTRPLQEIEELIERGKNFNVEVPELEHLEQVSRQIKWIEQAVRKRDHYMTLTDCRELVAGAEQVGLSDTNEH
LIHFKELARHGDAWEMKAKELMSVEAVHYQQLEALSAQASRFPVSPDTLAAVDAILTKQREAQKRIQTLYEKSKD
PEMKNRPKYKDIRDLMESLEHMTSRPIGAIDLEREQKRHEDWMRKGKKLFGKANAPLHILRSHMEYVAKRNSYCF
DLEDSYRPPVEPSSRDNSPEGLLENPSNPNNMWGPKSRKRDVFCICRHSEAGMMIECEVCHEWYHGKCLKIARGK
VKEFDKYTCPICDWRQKIPRDAARPKLEDLQDWHAEIATLPFQPEEEEVLESIINQATAFRDFLHGFTNAACTTT
EEVPTLIFYLRKIEGAEVLLTFETNFFRQEIHKWAPVAPEPPPILEQSLSTRKPRPTKQQKIMAQLGVNRPEDLP
EHLRPKHIGVTKRKSVDAQSQAATGQSAPMQPPPPTSSSGQPPGTGPTLAQMADPNAAPYPFSANYSLPASDSTP
AFAPTSSSAFLPHAAASQSPSFLPRSPPPQPDLEPSLFSPPRFGHDPQFASSSPRQNLDDVFADLTNQEIDPEAE
TQPMENTHANEALEALVVSNDSSRAASVQEESIQNGENGGPQGGPKLDGTNGGLEDEEL*
Coding >Pro_DTO070G2_2|g7805.t1
ATGGGAGCTCCGGCCTCTGCCGGGGCGACCTCGACGGCCGCAGCAAGCCAGCCGACTCGGTCCTCGAGTACCCAT
CCGTCGCACTCCCACAACGTGCCCCTGAGCGCTCGCAGGTCCACACCTCTCGATTTGTCCACCGTGGAACGGCGC
GGACAGCCCAACAACCCCAGAGAACCATCCAAGCGCATTCGTCCTCATGGTATCCCAGAAGCCCCGACCTTCCGT
CCGACAGAGGAGGAATTCAAAGACCCGGTGGCCTATATTCAGAAGATCGCTCCGGAGGGGAAGAAGTATGGAATT
TGCCGAGTGGTTCCACCAGAGGGCTGGCAACCGACTTTCGCAATCGATACAGAGCGATTCCACTTCAAGACACGT
CGACAAGAGCTGAATTCGGTCGAAGGAGGAAACCGCGCGAACATGAATTATGTCGATGGACTTGCCATGTTTCAC
AAACAGCATGGGACTAACTATAGCCGGCTACCCAGCGTCGACAAGCGACCATTAGATCTCTACAAACTTAAAAAG
GCAGTAGAGAGTCGTGGTGGGTTTGAATCAGTGTGCAAGACCAAAAAATGGGCCGAAATTGGTCGTGATCTTGGA
TACAGCGGCAAGATAATGTCTTCTTTGTCCACTTCGCTCAAGAACTCATACCAGCGGTATTTGCAGCCGTACGAG
GAATACCTGGCGCGGGCCAAGCCCGGTGTGCAACAACAGCTCGAGCTTGAACATGGTGGTCCATACACCCCTTCG
CCTCTACAATCCCCCATGACTCACAAGCCAATGTTGGATGAAAATGGCACGCCTTCTAAAATTCGCGATGACACT
CCTAGCTTGCCTCGAATGGCTGCTTCGCATACCCCAATGGCATTTACTCCAGTGGCACATTCTCCAATGGCACAC
ACTCCAATGGAAAAGTCCCCAGAGAAGCCAACACCCCCGATCGAACCTACTCCTCCCCCTGCTTCACGCCCAGCA
CCCACGAGCTTCACTCCCGTCAACTCCGGCCTCGGTGGCTTTACCGCTGTCAATCACTCTCCTTTCACGCCCGTG
AACAACGGCCCGCCAATCAAGCGGGAGGGAGAGAACGGCACATTGACACCCAAAGTCGTTTCCGAGCATGGTTTC
GTCTCAACGCCTGTAAATGGTCAAGATGAGGAGTCTCTGAAGCGTGGTATCAGCCGCGAGGCCAGTTCTCAGTGT
GAAAATGGCGACGACGATGATGGAAGCGGTCGACGCAGCAAGCGCCTCAAGAAAGATTCCCTTCCAACCGTTGCT
GGTTCTCATATGTCGCTCCTTCGCCCAGCACCGGTTAAATCGCGCAAGGATGGCTCCCAGCCAGCTGGAGAGAAA
TGCGAGACATGTGGCAAATCCGATGATCAAGGGATTATTCTAGTATGCGACGGCTGCGAGCTTGGATACCACAAA
GCGTGTCTCGATCCCTCTACTACCACACCATCGGAACATGACTGGCACTGTCCCAAGTGTCTAGTCGGCACAGGA
GAATTCGGATTTGAAGACGGCGGTGTTTACTCACTCAAACAGTTCCAGGAGAAGGCAAACGAGTTCAAGAAGAAG
TACTTCGCATCGAAAATGCCCTTCGATCCAGTTCTCAACACTCATCGCCGCGAAACCGAGGACGACGTGGAGGCC
GAATTCTGGAAGCTTGTCGTTGATCTACATGAGACCGTCGAAGTCGAGTACGGCGCCGACATCCATTCGACCACG
CATGGTAGTGGATTCCCAACTATCGAGCGGAACCCCCTTGATCCATTTTCGTCAGATCCTTGGAACCTAAATGTC
CTTCCATTCTATGGAGACTCGCTCTTCCGTTACATCAAGTCTGATATCTCTGGCATGACCGTTCCGTGGGTTTAT
GTGGGGATGTGTTTCTCTACTTTCTGCTGGCATAATGAGGATCACTACGCGTATTCGGCCAACTACCAACACTTC
GGTGCTACCAAGACCTGGTACGGAATCCCAGGCGCCGATGCAGAGGCCTTTGAGGCGGCCATGCGGGATGCAGTT
CCGGAGCTTTTCGAAGGCCAGCCTGATCTTCTTTTCCAGCTCGTCACCCTCATGCCGCCAGACAAGCTTCGCAAG
GCCGGAGTCAACGTTTATGCGTTGGATCAGCGAGCTGGTCAATTTGTGCTCACGTTCCCTCAAGCATACCATGCC
GGCTTTAATCACGGTTTTAATTTCAATGAAGCAGTCAACTTCGCGCCTGCGGACTGGGAACCATACGGTGCAGCA
GGTGTTGATCGTCTTCAGAACTTCCGCAGGCACCCGTGTTTCTCCCACGATGAACTACTTCTCACCGCTGCTGCA
CGTGATACCACTATTGCTACTGCTAAGTGGCTTGCGCCTGCACTAGCAAGAACGTGCGCCCGTGAACTGAGGGAT
CGGGCTGCTTTCTTATACCGGCAAAAAGAAATTTCTGCTCGCACCCCAGGCTTTGGTCCTGACTCCATGGCAGAT
GATGTGCAGCCGAGATTCGTAGTTGAGAATGAAGACCTTTCCGAGGATGATTACCAGTGCCAACATTGCAAGGCC
TACGCTTACCTCACTCAGTTCCGTTGTCACAAATCAGGCAAGACTGTCTGTTTATCGCACGTTGACACCTATGAC
TGCTGTGGCGAAACTCTTGCTCAGAAGCTGTGTGGCTCAGGACACACAGTCCGATATCGCATGGGTGATGAAGAA
TTGCAGTCTCTCGTGCAGAAAGTCCAAGAACGGGCCAGAATTCCCGAAGCATGGTCCGAAAAGCTCGACAAAACC
CTGGAGGATGAACCGAAGCCCCAGCTTAAGGCCCTTCATAACTTGCTAAATGAAGGTGAGAAAATCCCATACCAC
TTGCCAGGCCTTCAAGATCTTGCGGCCTTCGTCCAGCGTTGCGATAAATGGGTTGAAGAAGCCAACAACTACATT
ACCCGGAAGCAGCAGAACCGGAAAAAAAACGAGAAAGCTTGGCGCAGGGGCAGTACCAAGGCGTCGCAGCTGGAC
GATCGCGATCGCGAAGTCCGCAGAATTGAACATATCTACGCCCTTCAGGCAGAGGCTGATAAACTTTCGTTCGAC
TGTCCACAGATGGCGGTGTTGGAAGAGAAAACCCGCGAAATCGAGAAATTCCAACAGGATATTAATAATGCCCTC
ATGCACCCGCACACCCGGCCCCTCCAGGAGATTGAAGAACTCATCGAACGCGGCAAAAACTTCAACGTGGAAGTC
CCGGAACTGGAACACCTAGAGCAAGTCTCCCGCCAAATCAAATGGATTGAACAAGCCGTGCGCAAACGAGACCAC
TACATGACCCTTACCGATTGCCGGGAACTTGTCGCTGGTGCTGAACAGGTCGGCCTCTCTGATACCAACGAACAC
TTAATTCATTTCAAGGAACTTGCTCGTCACGGGGATGCGTGGGAAATGAAGGCCAAGGAATTAATGTCCGTCGAG
GCCGTTCACTATCAGCAATTAGAAGCTCTTTCTGCGCAGGCGTCTCGTTTTCCGGTTTCACCTGATACCCTCGCG
GCCGTCGATGCTATATTGACCAAGCAGCGTGAGGCGCAAAAACGGATACAGACTCTGTATGAAAAGAGCAAGGAC
CCGGAGATGAAGAATCGGCCCAAGTACAAGGACATCCGAGACCTCATGGAATCTCTTGAGCACATGACGAGTCGA
CCCATCGGGGCGATCGACTTGGAACGTGAACAAAAGCGCCATGAAGACTGGATGAGAAAAGGGAAAAAGCTGTTC
GGTAAGGCGAACGCGCCTCTCCATATTCTAAGATCCCATATGGAATACGTCGCGAAGCGGAACTCGTACTGTTTC
GACCTAGAGGACAGTTACCGACCTCCTGTGGAGCCTTCGTCTCGAGACAATTCTCCCGAAGGTTTGCTTGAGAAT
CCGAGCAATCCCAACAACATGTGGGGCCCAAAGTCACGAAAGCGAGATGTGTTCTGTATTTGCAGGCACTCCGAG
GCAGGAATGATGATTGAATGTGAAGTCTGCCACGAATGGTACCATGGGAAATGTTTGAAGATTGCTAGGGGTAAA
GTGAAGGAATTCGACAAGTACACTTGCCCAATCTGCGACTGGCGTCAAAAGATCCCGCGTGACGCTGCTCGTCCC
AAGCTTGAAGATCTGCAAGATTGGCACGCGGAGATCGCAACTTTGCCTTTCCAGCCCGAGGAAGAAGAAGTTCTT
GAGAGTATCATTAATCAAGCGACAGCCTTTCGTGATTTCCTGCATGGCTTCACGAATGCTGCCTGCACAACGACT
GAGGAAGTGCCTACTCTAATATTCTACCTTCGCAAAATCGAGGGCGCTGAGGTTCTTCTCACCTTTGAGACGAAT
TTCTTCCGGCAGGAGATACACAAGTGGGCACCCGTCGCACCAGAACCCCCTCCAATTCTGGAACAATCTCTCTCA
ACACGAAAACCGCGCCCGACCAAGCAACAGAAAATAATGGCTCAGCTTGGAGTCAATCGTCCAGAGGATCTCCCG
GAGCATCTTCGCCCCAAGCACATTGGCGTTACCAAAAGGAAATCTGTTGATGCTCAATCACAGGCAGCTACTGGT
CAATCCGCACCCATGCAACCACCACCACCGACTTCTAGTAGCGGACAACCTCCTGGCACAGGTCCAACGTTGGCT
CAGATGGCAGATCCGAATGCTGCACCATACCCATTCTCCGCAAACTATTCATTACCCGCGAGCGATTCCACGCCT
GCTTTTGCACCTACTTCCTCCTCGGCTTTCCTCCCGCATGCAGCCGCTTCTCAATCCCCCTCATTCCTACCACGC
TCTCCTCCTCCTCAGCCTGACCTGGAACCCTCCCTATTCAGCCCTCCACGCTTCGGTCATGATCCCCAGTTCGCG
AGCAGCAGCCCTCGTCAGAACCTAGATGATGTATTTGCAGACCTGACCAACCAAGAGATTGACCCTGAAGCTGAG
ACCCAGCCCATGGAGAATACCCATGCTAATGAGGCCCTGGAGGCCCTCGTGGTCAGTAATGACAGTAGTCGTGCT
GCCTCTGTTCAAGAGGAATCGATTCAAAATGGCGAAAACGGTGGTCCGCAGGGTGGGCCCAAACTCGACGGCACT
AATGGTGGCCTTGAGGACGAAGAACTTTGA
Transcript >Pro_DTO070G2_2|g7805.t1
ATGGGAGCTCCGGCCTCTGCCGGGGCGACCTCGACGGCCGCAGCAAGCCAGCCGACTCGGTCCTCGAGTACCCAT
CCGTCGCACTCCCACAACGTGCCCCTGAGCGCTCGCAGGTCCACACCTCTCGATTTGTCCACCGTGGAACGGCGC
GGACAGCCCAACAACCCCAGAGAACCATCCAAGCGCATTCGTCCTCATGGTATCCCAGAAGCCCCGACCTTCCGT
CCGACAGAGGAGGAATTCAAAGACCCGGTGGCCTATATTCAGAAGATCGCTCCGGAGGGGAAGAAGTATGGAATT
TGCCGAGTGGTTCCACCAGAGGGCTGGCAACCGACTTTCGCAATCGATACAGAGCGATTCCACTTCAAGACACGT
CGACAAGAGCTGAATTCGGTCGAAGGAGGAAACCGCGCGAACATGAATTATGTCGATGGACTTGCCATGTTTCAC
AAACAGCATGGGACTAACTATAGCCGGCTACCCAGCGTCGACAAGCGACCATTAGATCTCTACAAACTTAAAAAG
GCAGTAGAGAGTCGTGGTGGGTTTGAATCAGTGTGCAAGACCAAAAAATGGGCCGAAATTGGTCGTGATCTTGGA
TACAGCGGCAAGATAATGTCTTCTTTGTCCACTTCGCTCAAGAACTCATACCAGCGGTATTTGCAGCCGTACGAG
GAATACCTGGCGCGGGCCAAGCCCGGTGTGCAACAACAGCTCGAGCTTGAACATGGTGGTCCATACACCCCTTCG
CCTCTACAATCCCCCATGACTCACAAGCCAATGTTGGATGAAAATGGCACGCCTTCTAAAATTCGCGATGACACT
CCTAGCTTGCCTCGAATGGCTGCTTCGCATACCCCAATGGCATTTACTCCAGTGGCACATTCTCCAATGGCACAC
ACTCCAATGGAAAAGTCCCCAGAGAAGCCAACACCCCCGATCGAACCTACTCCTCCCCCTGCTTCACGCCCAGCA
CCCACGAGCTTCACTCCCGTCAACTCCGGCCTCGGTGGCTTTACCGCTGTCAATCACTCTCCTTTCACGCCCGTG
AACAACGGCCCGCCAATCAAGCGGGAGGGAGAGAACGGCACATTGACACCCAAAGTCGTTTCCGAGCATGGTTTC
GTCTCAACGCCTGTAAATGGTCAAGATGAGGAGTCTCTGAAGCGTGGTATCAGCCGCGAGGCCAGTTCTCAGTGT
GAAAATGGCGACGACGATGATGGAAGCGGTCGACGCAGCAAGCGCCTCAAGAAAGATTCCCTTCCAACCGTTGCT
GGTTCTCATATGTCGCTCCTTCGCCCAGCACCGGTTAAATCGCGCAAGGATGGCTCCCAGCCAGCTGGAGAGAAA
TGCGAGACATGTGGCAAATCCGATGATCAAGGGATTATTCTAGTATGCGACGGCTGCGAGCTTGGATACCACAAA
GCGTGTCTCGATCCCTCTACTACCACACCATCGGAACATGACTGGCACTGTCCCAAGTGTCTAGTCGGCACAGGA
GAATTCGGATTTGAAGACGGCGGTGTTTACTCACTCAAACAGTTCCAGGAGAAGGCAAACGAGTTCAAGAAGAAG
TACTTCGCATCGAAAATGCCCTTCGATCCAGTTCTCAACACTCATCGCCGCGAAACCGAGGACGACGTGGAGGCC
GAATTCTGGAAGCTTGTCGTTGATCTACATGAGACCGTCGAAGTCGAGTACGGCGCCGACATCCATTCGACCACG
CATGGTAGTGGATTCCCAACTATCGAGCGGAACCCCCTTGATCCATTTTCGTCAGATCCTTGGAACCTAAATGTC
CTTCCATTCTATGGAGACTCGCTCTTCCGTTACATCAAGTCTGATATCTCTGGCATGACCGTTCCGTGGGTTTAT
GTGGGGATGTGTTTCTCTACTTTCTGCTGGCATAATGAGGATCACTACGCGTATTCGGCCAACTACCAACACTTC
GGTGCTACCAAGACCTGGTACGGAATCCCAGGCGCCGATGCAGAGGCCTTTGAGGCGGCCATGCGGGATGCAGTT
CCGGAGCTTTTCGAAGGCCAGCCTGATCTTCTTTTCCAGCTCGTCACCCTCATGCCGCCAGACAAGCTTCGCAAG
GCCGGAGTCAACGTTTATGCGTTGGATCAGCGAGCTGGTCAATTTGTGCTCACGTTCCCTCAAGCATACCATGCC
GGCTTTAATCACGGTTTTAATTTCAATGAAGCAGTCAACTTCGCGCCTGCGGACTGGGAACCATACGGTGCAGCA
GGTGTTGATCGTCTTCAGAACTTCCGCAGGCACCCGTGTTTCTCCCACGATGAACTACTTCTCACCGCTGCTGCA
CGTGATACCACTATTGCTACTGCTAAGTGGCTTGCGCCTGCACTAGCAAGAACGTGCGCCCGTGAACTGAGGGAT
CGGGCTGCTTTCTTATACCGGCAAAAAGAAATTTCTGCTCGCACCCCAGGCTTTGGTCCTGACTCCATGGCAGAT
GATGTGCAGCCGAGATTCGTAGTTGAGAATGAAGACCTTTCCGAGGATGATTACCAGTGCCAACATTGCAAGGCC
TACGCTTACCTCACTCAGTTCCGTTGTCACAAATCAGGCAAGACTGTCTGTTTATCGCACGTTGACACCTATGAC
TGCTGTGGCGAAACTCTTGCTCAGAAGCTGTGTGGCTCAGGACACACAGTCCGATATCGCATGGGTGATGAAGAA
TTGCAGTCTCTCGTGCAGAAAGTCCAAGAACGGGCCAGAATTCCCGAAGCATGGTCCGAAAAGCTCGACAAAACC
CTGGAGGATGAACCGAAGCCCCAGCTTAAGGCCCTTCATAACTTGCTAAATGAAGGTGAGAAAATCCCATACCAC
TTGCCAGGCCTTCAAGATCTTGCGGCCTTCGTCCAGCGTTGCGATAAATGGGTTGAAGAAGCCAACAACTACATT
ACCCGGAAGCAGCAGAACCGGAAAAAAAACGAGAAAGCTTGGCGCAGGGGCAGTACCAAGGCGTCGCAGCTGGAC
GATCGCGATCGCGAAGTCCGCAGAATTGAACATATCTACGCCCTTCAGGCAGAGGCTGATAAACTTTCGTTCGAC
TGTCCACAGATGGCGGTGTTGGAAGAGAAAACCCGCGAAATCGAGAAATTCCAACAGGATATTAATAATGCCCTC
ATGCACCCGCACACCCGGCCCCTCCAGGAGATTGAAGAACTCATCGAACGCGGCAAAAACTTCAACGTGGAAGTC
CCGGAACTGGAACACCTAGAGCAAGTCTCCCGCCAAATCAAATGGATTGAACAAGCCGTGCGCAAACGAGACCAC
TACATGACCCTTACCGATTGCCGGGAACTTGTCGCTGGTGCTGAACAGGTCGGCCTCTCTGATACCAACGAACAC
TTAATTCATTTCAAGGAACTTGCTCGTCACGGGGATGCGTGGGAAATGAAGGCCAAGGAATTAATGTCCGTCGAG
GCCGTTCACTATCAGCAATTAGAAGCTCTTTCTGCGCAGGCGTCTCGTTTTCCGGTTTCACCTGATACCCTCGCG
GCCGTCGATGCTATATTGACCAAGCAGCGTGAGGCGCAAAAACGGATACAGACTCTGTATGAAAAGAGCAAGGAC
CCGGAGATGAAGAATCGGCCCAAGTACAAGGACATCCGAGACCTCATGGAATCTCTTGAGCACATGACGAGTCGA
CCCATCGGGGCGATCGACTTGGAACGTGAACAAAAGCGCCATGAAGACTGGATGAGAAAAGGGAAAAAGCTGTTC
GGTAAGGCGAACGCGCCTCTCCATATTCTAAGATCCCATATGGAATACGTCGCGAAGCGGAACTCGTACTGTTTC
GACCTAGAGGACAGTTACCGACCTCCTGTGGAGCCTTCGTCTCGAGACAATTCTCCCGAAGGTTTGCTTGAGAAT
CCGAGCAATCCCAACAACATGTGGGGCCCAAAGTCACGAAAGCGAGATGTGTTCTGTATTTGCAGGCACTCCGAG
GCAGGAATGATGATTGAATGTGAAGTCTGCCACGAATGGTACCATGGGAAATGTTTGAAGATTGCTAGGGGTAAA
GTGAAGGAATTCGACAAGTACACTTGCCCAATCTGCGACTGGCGTCAAAAGATCCCGCGTGACGCTGCTCGTCCC
AAGCTTGAAGATCTGCAAGATTGGCACGCGGAGATCGCAACTTTGCCTTTCCAGCCCGAGGAAGAAGAAGTTCTT
GAGAGTATCATTAATCAAGCGACAGCCTTTCGTGATTTCCTGCATGGCTTCACGAATGCTGCCTGCACAACGACT
GAGGAAGTGCCTACTCTAATATTCTACCTTCGCAAAATCGAGGGCGCTGAGGTTCTTCTCACCTTTGAGACGAAT
TTCTTCCGGCAGGAGATACACAAGTGGGCACCCGTCGCACCAGAACCCCCTCCAATTCTGGAACAATCTCTCTCA
ACACGAAAACCGCGCCCGACCAAGCAACAGAAAATAATGGCTCAGCTTGGAGTCAATCGTCCAGAGGATCTCCCG
GAGCATCTTCGCCCCAAGCACATTGGCGTTACCAAAAGGAAATCTGTTGATGCTCAATCACAGGCAGCTACTGGT
CAATCCGCACCCATGCAACCACCACCACCGACTTCTAGTAGCGGACAACCTCCTGGCACAGGTCCAACGTTGGCT
CAGATGGCAGATCCGAATGCTGCACCATACCCATTCTCCGCAAACTATTCATTACCCGCGAGCGATTCCACGCCT
GCTTTTGCACCTACTTCCTCCTCGGCTTTCCTCCCGCATGCAGCCGCTTCTCAATCCCCCTCATTCCTACCACGC
TCTCCTCCTCCTCAGCCTGACCTGGAACCCTCCCTATTCAGCCCTCCACGCTTCGGTCATGATCCCCAGTTCGCG
AGCAGCAGCCCTCGTCAGAACCTAGATGATGTATTTGCAGACCTGACCAACCAAGAGATTGACCCTGAAGCTGAG
ACCCAGCCCATGGAGAATACCCATGCTAATGAGGCCCTGGAGGCCCTCGTGGTCAGTAATGACAGTAGTCGTGCT
GCCTCTGTTCAAGAGGAATCGATTCAAAATGGCGAAAACGGTGGTCCGCAGGGTGGGCCCAAACTCGACGGCACT
AATGGTGGCCTTGAGGACGAAGAACTTTGA
Gene >Pro_DTO070G2_2|g7805.t1
ATGGGAGCTCCGGCCTCTGCCGGGGCGACCTCGACGGCCGCAGCAAGCCAGCCGACTCGGTCCTCGAGTACCCAT
CCGTCGCACTCCCACAACGTGCCCCTGAGCGCTCGCAGGTCCACACCTCTCGATTTGTCCACCGTGGAACGGCGC
GGACAGCCCAACAACCCCAGAGAACCATCCAAGCGCATTCGTCCTCATGGTATCCCAGAAGCCCCGACCTTCCGT
CCGACAGAGGAGGAATTCAAAGACCCGGTGGCCTATATTCAGAAGATCGCTCCGGAGGGGAAGAAGTATGGAATT
TGCCGAGTGGTTCCACCAGAGGGCTGGCAACCGACTTTCGCAATCGATACAGAGGTAGGATCCCTCCTTCACCGG
CCCACCGTCGCTTTCCGCGCATGATCACGTCTGACAATGGATATAGCGATTCCACTTCAAGACACGTCGACAAGA
GCTGAATTCGGTCGAAGGAGGTAAGGCCCCACGCCCAGCTTACTCCAGCTGGTAGGATCACACCGCAGTGCGGAT
CTAACCCTTATTCGAACATAGGAAACCGCGCGAACATGAATTATGTCGATGGACTTGCCATGTTTCACAAACAGC
ATGGGACTAACTATAGCCGGCTACCCAGCGTCGACAAGCGACCATTAGATCTCTACAAACTTAAAAAGGCAGTAG
AGAGTCGTGGTGGGTTTGAATCAGTGTGCAAGACCAAAAAATGGGCCGAAATTGGTCGTGATCTTGGATACAGCG
GCAAGATAATGTCTTCTTTGTCCACTTCGCTCAAGAACTCATACCAGCGGTATTTGCAGCCGTACGAGGAATACC
TGGCGCGGGCCAAGCCCGGTGTGCAACAACAGCTCGAGCTTGAACATGGTGGTCCATACACCCCTTCGCCTCTAC
AATCCCCCATGACTCACAAGCCAATGTTGGATGAAAATGGCACGCCTTCTAAAATTCGCGATGACACTCCTAGCT
TGCCTCGAATGGCTGCTTCGCATACCCCAATGGCATTTACTCCAGTGGCACATTCTCCAATGGCACACACTCCAA
TGGAAAAGTCCCCAGAGAAGCCAACACCCCCGATCGAACCTACTCCTCCCCCTGCTTCACGCCCAGCACCCACGA
GCTTCACTCCCGTCAACTCCGGCCTCGGTGGCTTTACCGCTGTCAATCACTCTCCTTTCACGCCCGTGAACAACG
GCCCGCCAATCAAGCGGGAGGGAGAGAACGGCACATTGACACCCAAAGTCGTTTCCGAGCATGGTTTCGTCTCAA
CGCCTGTAAATGGTCAAGATGAGGAGTCTCTGAAGCGTGGTATCAGCCGCGAGGCCAGTTCTCAGTGTGAAAATG
GCGACGACGATGATGGAAGCGGTCGACGCAGCAAGCGCCTCAAGAAAGGTACGCTTTTTTGCCCTTTTAATATTC
GAAGCAAATCTTGTCTAACCCTTCTAGATTCCCTTCCAACCGTTGCTGGTTCTCATATGTCGCTCCTTCGCCCAG
CACCGGTTAAATCGCGCAAGGATGGCTCCCAGCCAGCTGGAGAGGTAGGCGGGGGTTCGTGTCAGGGTTCTGATG
ATATACTGATCCATGAACAGAAATGCGAGACATGTGGCAAATCCGATGATCAAGGGATTATTCTAGTATGCGACG
GCTGCGAGCTTGGATACCACAAAGCGTGTCTCGATCCCTCTACTACCACACCATCGGAACATGACTGGCACTGTC
CCAAGTGTCTAGTCGGCACAGGAGAATTCGGATTTGAAGACGGCGGTGTTTACTCACTCAAACAGTTCCAGGAGA
AGGCAAACGAGTTCAAGAAGAAGTACTTCGCATCGAAAATGCCCTTCGATCCAGTTCTCAACACTCATCGCCGCG
AAACCGAGGACGACGTGGAGGCCGAATTCTGGAAGCTTGTCGTTGATCTACATGAGACCGTCGAAGTCGAGTACG
GCGCCGACATCCATTCGACCACGCATGGTAGTGGATTCCCAACTATCGAGCGGAACCCCCTTGATCCATTTTCGT
CAGATCCTTGGAACCTAAATGTCCTTCCATTCTATGGAGACTCGCTCTTCCGTTACATCAAGTCTGATATCTCTG
GCATGACCGTTCCGTGGGTTTATGTGGGGATGTGTTTCTCTACTTTCTGCTGGCATAATGAGGATCACTACGCGT
ATTCGGCCAACTACCAACACTTCGGTGCTACCAAGACCTGGTACGGAATCCCAGGCGCCGATGCAGAGGCCTTTG
AGGCGGCCATGCGGGATGCAGTTCCGGAGCTTTTCGAAGGCCAGCCTGATCTTCTTTTCCAGCTCGTCACCCTCA
TGCCGCCAGACAAGCTTCGCAAGGCCGGAGTCAACGTTTATGCGTTGGATCAGCGAGCTGGTCAATTTGTGCTCA
CGTTCCCTCAAGCATACCATGCCGGCTTTAATCACGGTTTTAATTTCAATGAAGCAGTCAACTTCGCGCCTGCGG
ACTGGGAACCATACGGTGCAGCAGGTGTTGATCGTCTTCAGAACTTCCGCAGGCACCCGTGTTTCTCCCACGATG
AACTACTTCTCACCGCTGCTGCACGTGATACCACTATTGCTACTGCTAAGTGGCTTGCGCCTGCACTAGCAAGAA
CGTGCGCCCGTGAACTGAGGGATCGGGCTGCTTTCTTATACCGGCAAAAAGAAATTTCTGCTCGCACCCCAGGCT
TTGGTCCTGACTCCATGGCAGATGATGTGCAGCCGAGATTCGTAGTTGAGAATGAAGACCTTTCCGAGGATGATT
ACCAGTGCCAACATTGCAAGGCCTACGCTTACCTCACTCAGTTCCGTTGTCACAAATCAGGCAAGACTGTCTGTT
TATCGCACGTTGACACCTATGACTGCTGTGGCGAAACTCTTGCTCAGAAGCTGTGTGGCTCAGGACACACAGTCC
GATATCGCATGGGTGATGAAGAATTGCAGTCTCTCGTGCAGAAAGTCCAAGAACGGGCCAGAATTCCCGAAGCAT
GGTCCGAAAAGCTCGACAAAACCCTGGAGGATGAACCGAAGCCCCAGCTTAAGGCCCTTCATAACTTGCTAAATG
AAGGTGAGAAAATCCCATACCACTTGCCAGGCCTTCAAGATCTTGCGGCCTTCGTCCAGCGTTGCGATAAATGGG
TTGAAGAAGCCAACAACTACATTACCCGGAAGCAGCAGAACCGGAAAAAAAACGAGAAAGCTTGGCGCAGGGGCA
GTACCAAGGCGTCGCAGCTGGACGATCGCGATCGCGAAGTCCGCAGAATTGAACATATCTACGCCCTTCAGGCAG
AGGCTGATAAACTTTCGTTCGACTGTCCACAGATGGCGGTGTTGGAAGAGAAAACCCGCGAAATCGAGAAATTCC
AACAGGATATTAATAATGCCCTCATGCACCCGCACACCCGGCCCCTCCAGGAGATTGAAGAACTCATCGAACGCG
GCAAAAACTTCAACGTGGAAGTCCCGGAACTGGAACACCTAGAGCAAGTCTCCCGCCAAATCAAATGGATTGAAC
AAGCCGTGCGCAAACGAGACCACTACATGACCCTTACCGATTGCCGGGAACTTGTCGCTGGTGCTGAACAGGTCG
GCCTCTCTGATACCAACGAACACTTAATTCATTTCAAGGAACTTGCTCGTCACGGGGATGCGTGGGAAATGAAGG
CCAAGGAATTAATGTCCGTCGAGGCCGTTCACTATCAGCAATTAGAAGCTCTTTCTGCGCAGGCGTCTCGTTTTC
CGGTTTCACCTGATACCCTCGCGGCCGTCGATGCTATATTGACCAAGCAGCGTGAGGCGCAAAAACGGATACAGA
CTCTGTATGAAAAGAGCAAGGACCCGGAGATGAAGAATCGGCCCAAGTACAAGGACATCCGAGACCTCATGGAAT
CTCTTGAGCACATGACGAGTCGACCCATCGGGGCGATCGACTTGGAACGTGAACAAAAGCGCCATGAAGACTGGA
TGAGAAAAGGGAAAAAGCTGTTCGGTAAGGCGAACGCGCCTCTCCATATTCTAAGATCCCATATGGAATACGTCG
CGAAGCGGAACTCGTACTGTTTCGACCTAGAGGACAGTTACCGACCTCCTGTGGAGCCTTCGTCTCGAGACAATT
CTCCCGAAGGTTTGCTTGAGAATCCGAGCAATCCCAACAACATGTGGGGCCCAAAGTCACGAAAGCGAGATGTGT
TCTGTATTTGCAGGCACTCCGAGGCAGGAATGATGATTGAATGTGAAGTCTGCCACGAATGGTAAGCCAAAAAAC
TTCCAGCTTGTGGTTTATTTACTGACCTGTGTAGGTACCATGGGAAATGTTTGAAGATTGCTAGGGGTAAAGTGA
AGGAATTCGACAAGTACACTTGCCCAATCTGCGACTGGCGTCAAAAGATCCCGCGTGACGCTGCTCGTCCCAAGC
TTGAAGATCTGCAAGATTGGCACGCGGAGATCGCAACTTTGCCTTTCCAGCCCGAGGAAGAAGAAGTTCTTGAGA
GTATCATTAATCAAGCGACAGCCTTTCGTGATTTCCTGCATGGCTTCACGAATGCTGCCTGCACAACGACTGAGG
AAGTGCCTACTCTAATATTCTACCTTCGCAAAATCGAGGGCGCTGAGGTTCTTCTCACCTTTGAGACGAATTTCT
TCCGGCAGGAGATACACAAGTGGGCACCCGTCGCACCAGAACCCCCTCCAATTCTGGAACAATCTCTCTCAACAC
GAAAACCGCGCCCGACCAAGCAACAGAAAATAATGGCTCAGCTTGGAGTCAATCGTCCAGAGGATCTCCCGGAGC
ATCTTCGCCCCAAGCACATTGGCGTTACCAAAAGGAAATCTGTTGATGCTCAATCACAGGCAGCTACTGGTCAAT
CCGCACCCATGCAACCACCACCACCGACTTCTAGTAGCGGACAACCTCCTGGCACAGGTCCAACGTTGGCTCAGA
TGGCAGATCCGAATGCTGCACCATACCCATTCTCCGCAAACTATTCATTACCCGCGAGCGATTCCACGCCTGCTT
TTGCACCTACTTCCTCCTCGGCTTTCCTCCCGCATGCAGCCGCTTCTCAATCCCCCTCATTCCTACCACGCTCTC
CTCCTCCTCAGCCTGACCTGGAACCCTCCCTATTCAGCCCTCCACGCTTCGGTCATGATCCCCAGTTCGCGAGCA
GCAGCCCTCGTCAGAACCTAGATGATGTATTTGCAGACCTGACCAACCAAGAGATTGACCCTGAAGCTGAGACCC
AGCCCATGGAGAATACCCATGCTAATGAGGCCCTGGAGGCCCTCGTGGTCAGTAATGACAGTAGTCGTGCTGCCT
CTGTTCAAGAGGAATCGATTCAAAATGGCGAAAACGGTGGTCCGCAGGGTGGGCCCAAACTCGACGGCACTAATG
GTGGCCTTGAGGACGAAGAACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail