Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7655.t1
Gene name
Locationscaffold_14:241585..242587
Strand+
Gene length (bp)1002
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01920 Prefoldin_2 Prefoldin subunit 7.2E-23 84 188

GO

GO Term Description Terminal node
GO:0006457 protein folding Yes
GO:0016272 prefoldin complex Yes
GO:0051082 unfolded protein binding Yes
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7655.t1
MYGCLLILCNLYILLPPTQTRYQTRKPTNPQRGQNKSQTRKNKQIPKPNQITTHQTAKMVQPRMLTKADETSAND
ENEVRREDQEKINRFSRLHQRETVLQEELKGKQKDKEDLEEVSMELELADEDELVPYKIGDSFFQLPLSDAQGML
STSTEKIDADVSKLEDSLGELREEMQQLKVALYARFGRSINLET*
Coding >Pro_DTO070G2_2|g7655.t1
ATGTATGGATGCCTATTAATACTCTGCAACCTATATATTCTACTACCACCCACTCAAACCCGATATCAAACGCGC
AAACCAACCAACCCGCAACGAGGACAGAACAAATCCCAGACACGAAAGAACAAACAAATCCCAAAGCCCAACCAA
ATAACCACCCACCAGACAGCCAAAATGGTGCAGCCGCGTATGCTCACAAAAGCGGACGAGACATCAGCCAATGAT
GAGAATGAAGTCCGTCGCGAGGATCAGGAGAAGATCAACCGGTTCAGTCGGTTGCATCAGCGCGAGACCGTGCTT
CAGGAGGAGTTGAAGGGGAAGCAGAAGGATAAGGAAGATTTGGAAGAGGTTTCGATGGAGTTGGAGCTTGCTGAT
GAAGATGAGCTTGTGCCCTACAAAATCGGCGACTCATTCTTCCAACTACCGCTATCAGACGCGCAGGGAATGCTC
TCGACATCAACAGAGAAGATCGATGCAGATGTTTCTAAGCTAGAGGACTCGCTTGGTGAGCTGCGTGAGGAAATG
CAGCAGCTGAAGGTTGCACTCTATGCGCGGTTTGGTCGGAGCATTAACCTGGAGACTTGA
Transcript >Pro_DTO070G2_2|g7655.t1
ATGTATGGATGCCTATTAATACTCTGCAACCTATATATTCTACTACCACCCACTCAAACCCGATATCAAACGCGC
AAACCAACCAACCCGCAACGAGGACAGAACAAATCCCAGACACGAAAGAACAAACAAATCCCAAAGCCCAACCAA
ATAACCACCCACCAGACAGCCAAAATGGTGCAGCCGCGTATGCTCACAAAAGCGGACGAGACATCAGCCAATGAT
GAGAATGAAGTCCGTCGCGAGGATCAGGAGAAGATCAACCGGTTCAGTCGGTTGCATCAGCGCGAGACCGTGCTT
CAGGAGGAGTTGAAGGGGAAGCAGAAGGATAAGGAAGATTTGGAAGAGGTTTCGATGGAGTTGGAGCTTGCTGAT
GAAGATGAGCTTGTGCCCTACAAAATCGGCGACTCATTCTTCCAACTACCGCTATCAGACGCGCAGGGAATGCTC
TCGACATCAACAGAGAAGATCGATGCAGATGTTTCTAAGCTAGAGGACTCGCTTGGTGAGCTGCGTGAGGAAATG
CAGCAGCTGAAGGTTGCACTCTATGCGCGGTTTGGTCGGAGCATTAACCTGGAGACTTGA
Gene >Pro_DTO070G2_2|g7655.t1
ATGTATGGATGTAAAGAAGATAGAAGCAAAATAGAAGAACCGATATATCCGAAAAAGAAGCCTACATAAGGCCTA
TTAATACTCTGCAACCTATATATTCTACTGTATAGATCCCTATCCCTACAAACACCAACCTCATCCAGCTCATCG
CCACGCACAGACCACCCACTCAAACCCGATATCAAACGCGCAAACCAACCAACCCGCAACGAGGACAGAACAAAT
CCCAGACACGAAAGAACAAACAAATCCCAAAGCCCAACCAAATAACCACCCACCAGACAGCCAAAATGGTGCAGC
CGCGTATGGTAAGCCCAACCCCCACCAAGCTCAAACGCGACAAACCCCACCAAAGCCCAGCTCGCAAGCTAATCG
GATCAACGCGCAGCTCACAAAAGCGGACGAGACATCAGCCAATGATGAGAATGAAGTCCGTCGCGAGGATCAGGA
GAAGATCAACCGGTTCAGTCGGTTGCATCAGCGCGAGACCGTGCTTCAGGAGGAGTTGAAGGGGAAGCAGGTATG
GACTTTGGACTTTTGAGGATTTTGTTCTCTGCCATGTATCGGATCTCTTGCTAACTGGTTTATAGAAGGATAAGG
AAGATTTGGAAGAGGTTTCGATGGAGTTGGAGCTTGCTGATGAAGATGAGCTTGTGCCGTAAGGAATACCTTTCC
CATCTATTCTTGCTTTTGTTTTTTTCGATCATGTTCTGTTGTGGCTTTTCTCTGTGATTCTCATCTCGGAGTATT
ACGAAGAAACCTAAAAAAGAGCAAGAACAGGAAGAAGCCATCACTAACAACCTTCACAGCTACAAAATCGGCGAC
TCATTCTTCCAACTACCGCTATCAGACGCGCAGGGAATGCTCTCGACATCAACAGAGAAGATCGATGCAGATGTT
TCTAAGCTAGAGGACTCGCTTGGTGAGCTGCGTGAGGAAATGCAGCAGCTGAAGGTTGCACTCTATGCGCGGTTT
GGTCGGAGCATTAACCTGGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail