Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7653.t1
Gene name
Locationscaffold_14:235765..237793
Strand-
Gene length (bp)2028
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07676 PD40 WD40-like Beta Propeller Repeat 2.4E-08 77 114
PF07676 PD40 WD40-like Beta Propeller Repeat 3.9E-02 125 159
PF07676 PD40 WD40-like Beta Propeller Repeat 2.3E-07 187 209
PF07676 PD40 WD40-like Beta Propeller Repeat 6.9E-04 342 362
PF07676 PD40 WD40-like Beta Propeller Repeat 2.3E-02 446 458
PF07676 PD40 WD40-like Beta Propeller Repeat 1.8E-01 504 519
PF07676 PD40 WD40-like Beta Propeller Repeat 2.5E-05 550 571

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7653.t1
MHFPASIALLGLALPSALALCPYAEQMNLEKRNTPSPHAHEPRKAASSDKKGIFYMNRIAPGTSELYVANVDGTD
ERPLLSNSIYEYHATFSPDGEWITFTGERNGDGNSDIYRVRTNGSDLEELVATSSVEDGAVVSPNGKQVAYVSTA
NGYKANIWVLDLESGKKWNLTDTVSTAANTSLPDGYFRPSWSPDGQWIAFSSDRNTGWYGHGDPIFQGVTGWEHT
QELSIYAIRPNGSDFRPVVSKSGYCLGSPKWSPDGERIVYYEMTRENTWNAHRPESLNSANSSIVSVEFATGANR
RVEAEGTGVKLFPQYLPNGTIAYAGKGSGIEGLHTTAGGYVNTTSEIIRSPAWSPDGKKVVYEKNAWTIRPMDKK
LYSWDTEWEYRFTDVFPQLSSTNKIALTEKQLGNSSIVSFNANGTDESLVYNDMESDFIDASSVAKGTAGAFNPA
WSPDGKWVSFGVGFWFQGRATGGGWLVRATANGSYSEVLSESTTTLSSNSSVINSGFPSFSHDGKKIVFRIWGTN
STLGDRSQLGLRVLDLETRKTTVLTNEWDNLPSFSPDGKRIVFTRKTSDYNYDICTMRPDGTDVKVLTSSGANDA
HAIWTWDGRIAYSSGMFGFQYECALYDQTFQPYGQVVVMNADGSNKRVLTDSIWEDSMPLYVPNSALKANAKVHK
*
Coding >Pro_DTO070G2_2|g7653.t1
ATGCATTTTCCCGCTTCAATTGCCCTGCTGGGCCTTGCCTTGCCGTCGGCTTTGGCTCTTTGCCCATATGCAGAG
CAGATGAACCTTGAGAAGAGGAACACGCCCTCTCCGCATGCGCACGAACCGCGCAAGGCGGCGTCGTCTGACAAG
AAGGGAATCTTCTACATGAACCGCATTGCTCCCGGGACATCAGAGCTTTATGTTGCCAATGTTGATGGCACTGAT
GAACGTCCTCTCCTCTCCAACTCTATCTATGAATACCATGCCACCTTTTCCCCCGATGGAGAATGGATCACCTTC
ACCGGAGAGCGCAATGGTGACGGTAATTCGGATATCTACCGCGTCCGGACCAACGGGTCTGACCTTGAGGAGTTG
GTAGCAACCTCCTCGGTGGAAGACGGAGCTGTCGTGTCTCCGAATGGAAAGCAAGTCGCCTATGTGTCCACTGCC
AATGGTTACAAGGCCAACATCTGGGTCCTGGATCTGGAGAGTGGCAAGAAATGGAACCTCACAGATACCGTCTCG
ACTGCCGCCAATACTTCTCTTCCTGATGGCTATTTCCGCCCTTCGTGGTCTCCCGACGGCCAATGGATTGCTTTC
TCGTCGGACCGTAACACTGGCTGGTACGGACACGGAGACCCCATCTTCCAAGGTGTCACCGGCTGGGAACATACA
CAGGAGCTGTCCATCTATGCTATCCGCCCCAATGGATCTGATTTCCGTCCCGTCGTGTCGAAGTCTGGTTACTGT
CTTGGTTCGCCCAAGTGGTCTCCCGATGGCGAGCGTATTGTTTACTACGAGATGACTCGTGAGAACACCTGGAAC
GCTCACCGTCCTGAGTCACTCAACTCTGCCAACTCCAGCATTGTCTCCGTGGAGTTTGCCACAGGCGCTAACCGT
CGCGTGGAAGCCGAGGGAACTGGCGTGAAGCTCTTCCCTCAATATCTCCCCAACGGCACTATCGCCTACGCCGGC
AAGGGTTCCGGTATCGAAGGACTCCACACCACTGCCGGTGGATACGTGAACACCACTAGCGAGATTATCCGCTCT
CCTGCCTGGTCTCCAGATGGCAAGAAGGTCGTCTATGAGAAGAACGCCTGGACTATCCGTCCTATGGACAAGAAG
TTGTACAGCTGGGACACGGAGTGGGAATATCGCTTCACCGACGTCTTCCCCCAGTTGTCCAGCACCAACAAGATC
GCTCTGACTGAGAAGCAGCTTGGAAACTCCTCCATTGTTTCCTTCAACGCCAACGGAACCGACGAGAGCCTAGTC
TACAATGACATGGAATCCGACTTCATTGACGCGTCGTCCGTCGCCAAGGGCACCGCAGGCGCCTTCAACCCGGCC
TGGTCGCCCGATGGCAAGTGGGTCTCCTTCGGAGTCGGCTTCTGGTTCCAAGGCCGCGCCACCGGCGGCGGCTGG
CTTGTAAGAGCCACTGCCAATGGCTCGTACTCCGAAGTCCTGTCCGAGAGCACCACAACCCTCAGCAGCAACAGC
AGCGTGATCAACTCCGGCTTCCCCAGCTTCTCGCACGACGGCAAGAAGATCGTCTTCCGCATTTGGGGAACAAAC
TCCACCCTGGGCGACAGATCCCAGCTCGGACTCCGTGTTCTGGATCTGGAGACCCGTAAGACCACTGTCTTGACC
AATGAGTGGGATAACCTGCCTTCCTTCTCCCCCGATGGAAAGAGAATCGTCTTTACCCGCAAGACCAGTGATTAC
AACTACGATATCTGCACTATGCGTCCTGATGGAACTGATGTCAAGGTTCTCACTAGCAGTGGTGCCAATGATGCT
CATGCCATCTGGACTTGGGATGGTCGCATTGCCTACTCTTCCGGCATGTTCGGCTTCCAGTACGAGTGTGCTCTC
TATGATCAGACTTTCCAGCCTTATGGTCAGGTCGTCGTTATGAATGCCGATGGCTCGAATAAGCGTGTGCTTACT
GATTCGATCTGGGAGGACTCGATGCCTCTCTATGTGCCGAACAGTGCCCTCAAGGCTAACGCCAAGGTCCACAAA
TAG
Transcript >Pro_DTO070G2_2|g7653.t1
ATGCATTTTCCCGCTTCAATTGCCCTGCTGGGCCTTGCCTTGCCGTCGGCTTTGGCTCTTTGCCCATATGCAGAG
CAGATGAACCTTGAGAAGAGGAACACGCCCTCTCCGCATGCGCACGAACCGCGCAAGGCGGCGTCGTCTGACAAG
AAGGGAATCTTCTACATGAACCGCATTGCTCCCGGGACATCAGAGCTTTATGTTGCCAATGTTGATGGCACTGAT
GAACGTCCTCTCCTCTCCAACTCTATCTATGAATACCATGCCACCTTTTCCCCCGATGGAGAATGGATCACCTTC
ACCGGAGAGCGCAATGGTGACGGTAATTCGGATATCTACCGCGTCCGGACCAACGGGTCTGACCTTGAGGAGTTG
GTAGCAACCTCCTCGGTGGAAGACGGAGCTGTCGTGTCTCCGAATGGAAAGCAAGTCGCCTATGTGTCCACTGCC
AATGGTTACAAGGCCAACATCTGGGTCCTGGATCTGGAGAGTGGCAAGAAATGGAACCTCACAGATACCGTCTCG
ACTGCCGCCAATACTTCTCTTCCTGATGGCTATTTCCGCCCTTCGTGGTCTCCCGACGGCCAATGGATTGCTTTC
TCGTCGGACCGTAACACTGGCTGGTACGGACACGGAGACCCCATCTTCCAAGGTGTCACCGGCTGGGAACATACA
CAGGAGCTGTCCATCTATGCTATCCGCCCCAATGGATCTGATTTCCGTCCCGTCGTGTCGAAGTCTGGTTACTGT
CTTGGTTCGCCCAAGTGGTCTCCCGATGGCGAGCGTATTGTTTACTACGAGATGACTCGTGAGAACACCTGGAAC
GCTCACCGTCCTGAGTCACTCAACTCTGCCAACTCCAGCATTGTCTCCGTGGAGTTTGCCACAGGCGCTAACCGT
CGCGTGGAAGCCGAGGGAACTGGCGTGAAGCTCTTCCCTCAATATCTCCCCAACGGCACTATCGCCTACGCCGGC
AAGGGTTCCGGTATCGAAGGACTCCACACCACTGCCGGTGGATACGTGAACACCACTAGCGAGATTATCCGCTCT
CCTGCCTGGTCTCCAGATGGCAAGAAGGTCGTCTATGAGAAGAACGCCTGGACTATCCGTCCTATGGACAAGAAG
TTGTACAGCTGGGACACGGAGTGGGAATATCGCTTCACCGACGTCTTCCCCCAGTTGTCCAGCACCAACAAGATC
GCTCTGACTGAGAAGCAGCTTGGAAACTCCTCCATTGTTTCCTTCAACGCCAACGGAACCGACGAGAGCCTAGTC
TACAATGACATGGAATCCGACTTCATTGACGCGTCGTCCGTCGCCAAGGGCACCGCAGGCGCCTTCAACCCGGCC
TGGTCGCCCGATGGCAAGTGGGTCTCCTTCGGAGTCGGCTTCTGGTTCCAAGGCCGCGCCACCGGCGGCGGCTGG
CTTGTAAGAGCCACTGCCAATGGCTCGTACTCCGAAGTCCTGTCCGAGAGCACCACAACCCTCAGCAGCAACAGC
AGCGTGATCAACTCCGGCTTCCCCAGCTTCTCGCACGACGGCAAGAAGATCGTCTTCCGCATTTGGGGAACAAAC
TCCACCCTGGGCGACAGATCCCAGCTCGGACTCCGTGTTCTGGATCTGGAGACCCGTAAGACCACTGTCTTGACC
AATGAGTGGGATAACCTGCCTTCCTTCTCCCCCGATGGAAAGAGAATCGTCTTTACCCGCAAGACCAGTGATTAC
AACTACGATATCTGCACTATGCGTCCTGATGGAACTGATGTCAAGGTTCTCACTAGCAGTGGTGCCAATGATGCT
CATGCCATCTGGACTTGGGATGGTCGCATTGCCTACTCTTCCGGCATGTTCGGCTTCCAGTACGAGTGTGCTCTC
TATGATCAGACTTTCCAGCCTTATGGTCAGGTCGTCGTTATGAATGCCGATGGCTCGAATAAGCGTGTGCTTACT
GATTCGATCTGGGAGGACTCGATGCCTCTCTATGTGCCGAACAGTGCCCTCAAGGCTAACGCCAAGGTCCACAAA
TAG
Gene >Pro_DTO070G2_2|g7653.t1
ATGCATTTTCCCGCTTCAATTGCCCTGCTGGGCCTTGCCTTGCCGTCGGCTTTGGCTCTTTGCCCATATGCAGAG
CAGATGAACCTTGAGAAGAGGAACACGCCCTCTCCGCATGCGCACGAACCGCGCAAGGCGGCGTCGTCTGACAAG
AAGGGAATCTTCTACATGAACCGCATTGCTCCCGGGACATCAGAGCTTTATGTTGCCAATGTTGATGGCACTGAT
GAACGTCCTCTCCTCTCCAACTCTATCTATGAATACCATGCCACCTTTTCCCCCGATGGAGAATGGATCACCTTC
ACCGGAGAGCGCAATGGTGACGGTAATTCGGATATCTACCGCGTCCGGACCAACGGGTCTGACCTTGAGGAGTTG
GTAGCAACCTCCTCGGTGGAAGACGGAGCTGTCGTGTCTCCGAATGGAAAGCAAGTCGCCTATGTGTCCACTGCC
AATGGTTACAAGGCCAACATCTGGGTCCTGGATCTGGAGAGTGGCAAGAAATGGAACCTCACAGATACCGTCTCG
ACTGCCGCCAATACTTCTCTTCCTGATGGCTATTTCCGCCCTTCGTGGTCTCCCGACGGCCAATGGATTGCTTTC
TCGTCGGACCGTAACACTGGCTGGTACGGACACGGAGACCCCATCTTCCAAGGTGTCACCGGCTGGGAACATACA
CAGGAGCTGTCCATCTATGCTATCCGCCCCAATGGATCTGATTTCCGTCCCGTCGTGTCGAAGTCTGGTTACTGT
CTTGGTTCGCCCAAGTGGTCTCCCGATGGCGAGCGTATTGTTTACTACGAGATGACTCGTGAGAACACCTGGAAC
GCTCACCGTCCTGAGTCACTCAACTCTGCCAACTCCAGCATTGTCTCCGTGGAGTTTGCCACAGGCGCTAACCGT
CGCGTGGAAGCCGAGGGAACTGGCGTGAAGCTCTTCCCTCAATATCTCCCCAACGGCACTATCGCCTACGCCGGC
AAGGGTTCCGGTATCGAAGGACTCCACACCACTGCCGGTGGATACGTGAACACCACTAGCGAGATTATCCGCTCT
CCTGCCTGGTCTCCAGATGGCAAGAAGGTCGTCTATGAGAAGAACGCCTGGACTATCCGTCCTATGGACAAGAAG
TTGTACAGCTGGGACACGGAGTGGGAATATCGCTTCACCGACGTCTTCCCCCAGTTGTCCAGCACCAACAAGATC
GCTCTGACTGAGAAGCAGCTTGGAAACTCCTCCATTGTTTCCTTCAACGCCAACGGAACCGACGAGAGCCTAGTC
TACAATGACATGGAATCCGACTTCATTGACGCGTCGTCCGTCGCCAAGGGCACCGCAGGCGCCTTCAACCCGGCC
TGGTCGCCCGATGGCAAGTGGGTCTCCTTCGGAGTCGGCTTCTGGTTCCAAGGCCGCGCCACCGGCGGCGGCTGG
CTTGTAAGAGCCACTGCCAATGGCTCGTACTCCGAAGTCCTGTCCGAGAGCACCACAACCCTCAGCAGCAACAGC
AGCGTGATCAACTCCGGCTTCCCCAGCTTCTCGCACGACGGCAAGAAGATCGTCTTCCGCATTTGGGGAACAAAC
TCCACCCTGGGCGACAGATCCCAGCTCGGACTCCGTGTTCTGGATCTGGAGACCCGTAAGACCACTGTCTTGACC
AATGAGTGGGATAACCTGCCTTCCTTCTCCCCCGATGGAAAGAGAATCGTCTTTACCCGCAAGACCAGTGATTAC
AACTACGATATCTGCACTATGCGTCCTGATGGAACTGATGTCAAGGTTCTCACTAGCAGTGGTGCCAATGATGCT
CATGCCATCTGGACTTGGGATGGTCGCATTGCCTACTCTTCCGGCATGTTCGGCTTCCAGTACGAGTGTGCTCTC
TATGATCAGACTTTCCAGCCTTATGGTCAGGTCGTCGTTATGAATGCCGATGGCTCGAATAAGCGTGTGCTTACT
GATTCGATCTGGGAGGACTCGATGCCTCTCTATGTGCCGAACAGTGCCCTCAAGGCTAACGCCAAGGTCCACAAA
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail