Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7569.t1
Gene name
Locationscaffold_14:2512..5121
Strand-
Gene length (bp)2609
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 2.2E-03 218 264
PF01476 LysM LysM domain 4.0E-02 363 393
PF01476 LysM LysM domain 1.2E-01 653 691
PF01476 LysM LysM domain 7.6E-05 724 756

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7569.t1
MRGMWTAPWALLISTALAQQPAGIRGFTSYPGLTDGCKEALSTNVSCPAFLPVVSPDNSLLDGDQVDELCVDTCY
SSLKSARATIKAACSETTDVIVVEDVAYPATFIADKYMLTYDISCRKDESGGYCDPQLLSWSNGSWPVNGSCSDC
WLGTLETQLNSPLGYDEGVADSFTSLTSSCSATGYSVTSPTAYALNATATATSSPATSSATTSCENYYQVKETDD
CNSVAKSLGVSTYYLLQTNDLDLYCQNFAAKVNQTLCVPSQCTTHTWQADDTCDSVVGGLANVTLPQFFSWNPNI
NSLCLNAIFFIGYEVCVSPPSGYLNQTAGGSDSSATETGVATGIAAVPTNAMDNSNRNCSQWYTVQKGDECAKVS
LAHSISLTDFYFLNPEIDANCTNLLLDEAYCVKAVGSITSYANYTVTGVLPITVTPVNFTNVNTDIPTATSDPGY
VYTGAALLPTASGTIPDCYDYENPSNYTSECVAMATFWGITMKQMVTWNPSLVNNASTCELNKENSYCILRYENS
TASTEDTDSGLCLPMNATEAGTAFNCNCFTSVDLSYSDVYTCDDIIYDYSLTMDDLVSWNSWLEGDCDTALYASL
NATDDRAICIGVGSAAATTTASGTATQTPTTTSSSSSMGPTPTDTVSGCEKFYTTTKGDDCATVETKFSITLAQF
YQWNPSVGSTCTNLWLGEAYCVKGPASTTSATASAPTQTGIASNCNQYYTVVSNDSCAKIETAYGITFAELYKWN
PAIGSDCEYLGVGYSVCVGVSS*
Coding >Pro_DTO070G2_2|g7569.t1
ATGCGTGGGATGTGGACTGCCCCGTGGGCTCTACTAATTTCCACGGCCCTTGCCCAGCAGCCTGCTGGCATTCGA
GGATTCACAAGCTATCCTGGTCTCACCGATGGTTGCAAAGAAGCCTTGTCGACTAATGTGTCCTGTCCGGCATTT
CTGCCCGTTGTGTCCCCAGACAACTCTCTTCTGGATGGTGATCAAGTCGATGAACTTTGCGTCGACACCTGCTAT
AGTTCTTTGAAAAGCGCCAGAGCAACCATCAAGGCGGCCTGCTCAGAGACCACCGATGTGATCGTCGTTGAGGAT
GTAGCTTATCCAGCTACATTTATCGCTGACAAGTACATGTTGACCTATGACATATCTTGTCGGAAAGATGAGTCC
GGGGGTTACTGTGACCCGCAATTGCTCTCCTGGTCCAACGGGTCTTGGCCTGTTAATGGTTCTTGCTCGGATTGT
TGGCTGGGGACATTAGAGACTCAATTAAACAGCCCCTTAGGGTATGATGAGGGCGTGGCGGACAGCTTCACTTCT
TTGACGTCGAGCTGCAGCGCCACGGGTTACTCAGTCACTTCCCCAACTGCGTACGCGCTTAATGCAACTGCGACT
GCAACCAGCTCGCCTGCAACCAGCTCGGCAACAACCAGCTGCGAAAACTATTATCAGGTGAAGGAAACAGACGAC
TGTAACTCCGTGGCAAAGTCGCTGGGAGTCTCTACATACTACCTACTGCAAACCAACGACTTGGATCTCTACTGT
CAAAACTTTGCGGCGAAAGTCAACCAGACACTCTGTGTCCCCTCGCAGTGCACCACACACACCTGGCAGGCTGAT
GACACTTGCGATAGTGTCGTCGGCGGCCTCGCGAATGTGACTCTTCCGCAGTTCTTCTCCTGGAACCCCAATATC
AATTCCCTCTGTCTGAATGCGATTTTCTTCATTGGATATGAGGTGTGTGTGAGTCCCCCGAGTGGCTACTTGAAT
CAGACTGCTGGTGGATCCGACTCAAGCGCAACCGAAACTGGAGTAGCCACTGGCATTGCAGCGGTCCCAACAAAT
GCTATGGACAATAGCAACCGCAACTGCAGCCAGTGGTATACGGTTCAAAAAGGCGATGAATGTGCCAAGGTCTCT
CTCGCCCATTCTATCTCCCTTACCGACTTCTACTTCCTGAACCCAGAAATCGACGCAAACTGCACAAACCTCCTG
CTTGACGAGGCATACTGTGTTAAGGCCGTTGGTTCAATCACCAGCTACGCAAACTACACGGTGACTGGAGTATTG
CCCATCACCGTCACGCCCGTCAACTTCACCAACGTGAATACTGACATACCTACGGCCACAAGCGATCCTGGCTAT
GTGTATACGGGAGCGGCGCTCCTTCCCACCGCTTCGGGCACTATCCCAGACTGCTATGACTACGAAAATCCTTCC
AACTATACTTCTGAGTGTGTGGCGATGGCGACATTTTGGGGCATTACAATGAAACAAATGGTCACTTGGAATCCA
AGTCTTGTGAACAACGCAAGCACCTGTGAGCTCAACAAGGAAAACAGCTACTGCATCCTGCGGTATGAAAACAGC
ACTGCCTCAACGGAGGATACTGATAGTGGGCTCTGCCTTCCCATGAATGCTACGGAGGCTGGAACGGCATTCAAC
TGCAATTGCTTCACCTCCGTCGACCTGTCTTACTCTGACGTATACACCTGCGACGACATCATTTACGATTACAGC
CTGACCATGGACGACCTTGTGTCCTGGAACAGCTGGCTGGAAGGAGACTGTGACACTGCGCTCTATGCCAGCCTA
AATGCCACGGATGACCGCGCCATCTGTATTGGTGTCGGGTCTGCAGCTGCAACGACTACAGCCAGTGGAACTGCC
ACCCAAACCCCCACCACCACCTCCTCCTCCTCTTCCATGGGGCCCACTCCAACCGACACTGTGTCGGGATGCGAG
AAGTTCTACACCACTACAAAGGGCGACGACTGTGCCACAGTCGAGACCAAGTTCAGCATCACCCTTGCTCAATTC
TATCAGTGGAACCCCAGTGTTGGCTCTACTTGTACCAATTTGTGGCTAGGAGAAGCATACTGTGTCAAGGGACCG
GCATCGACGACCAGCGCAACAGCAAGTGCACCCACTCAGACGGGAATCGCGTCGAACTGCAACCAGTATTACACG
GTGGTGTCGAACGATTCGTGCGCCAAGATCGAGACCGCGTATGGTATTACTTTTGCTGAACTATACAAGTGGAAT
CCTGCGATTGGATCGGACTGTGAGTATCTAGGAGTCGGGTACTCGGTGTGTGTGGGGGTTTCTTCATAG
Transcript >Pro_DTO070G2_2|g7569.t1
ATGCGTGGGATGTGGACTGCCCCGTGGGCTCTACTAATTTCCACGGCCCTTGCCCAGCAGCCTGCTGGCATTCGA
GGATTCACAAGCTATCCTGGTCTCACCGATGGTTGCAAAGAAGCCTTGTCGACTAATGTGTCCTGTCCGGCATTT
CTGCCCGTTGTGTCCCCAGACAACTCTCTTCTGGATGGTGATCAAGTCGATGAACTTTGCGTCGACACCTGCTAT
AGTTCTTTGAAAAGCGCCAGAGCAACCATCAAGGCGGCCTGCTCAGAGACCACCGATGTGATCGTCGTTGAGGAT
GTAGCTTATCCAGCTACATTTATCGCTGACAAGTACATGTTGACCTATGACATATCTTGTCGGAAAGATGAGTCC
GGGGGTTACTGTGACCCGCAATTGCTCTCCTGGTCCAACGGGTCTTGGCCTGTTAATGGTTCTTGCTCGGATTGT
TGGCTGGGGACATTAGAGACTCAATTAAACAGCCCCTTAGGGTATGATGAGGGCGTGGCGGACAGCTTCACTTCT
TTGACGTCGAGCTGCAGCGCCACGGGTTACTCAGTCACTTCCCCAACTGCGTACGCGCTTAATGCAACTGCGACT
GCAACCAGCTCGCCTGCAACCAGCTCGGCAACAACCAGCTGCGAAAACTATTATCAGGTGAAGGAAACAGACGAC
TGTAACTCCGTGGCAAAGTCGCTGGGAGTCTCTACATACTACCTACTGCAAACCAACGACTTGGATCTCTACTGT
CAAAACTTTGCGGCGAAAGTCAACCAGACACTCTGTGTCCCCTCGCAGTGCACCACACACACCTGGCAGGCTGAT
GACACTTGCGATAGTGTCGTCGGCGGCCTCGCGAATGTGACTCTTCCGCAGTTCTTCTCCTGGAACCCCAATATC
AATTCCCTCTGTCTGAATGCGATTTTCTTCATTGGATATGAGGTGTGTGTGAGTCCCCCGAGTGGCTACTTGAAT
CAGACTGCTGGTGGATCCGACTCAAGCGCAACCGAAACTGGAGTAGCCACTGGCATTGCAGCGGTCCCAACAAAT
GCTATGGACAATAGCAACCGCAACTGCAGCCAGTGGTATACGGTTCAAAAAGGCGATGAATGTGCCAAGGTCTCT
CTCGCCCATTCTATCTCCCTTACCGACTTCTACTTCCTGAACCCAGAAATCGACGCAAACTGCACAAACCTCCTG
CTTGACGAGGCATACTGTGTTAAGGCCGTTGGTTCAATCACCAGCTACGCAAACTACACGGTGACTGGAGTATTG
CCCATCACCGTCACGCCCGTCAACTTCACCAACGTGAATACTGACATACCTACGGCCACAAGCGATCCTGGCTAT
GTGTATACGGGAGCGGCGCTCCTTCCCACCGCTTCGGGCACTATCCCAGACTGCTATGACTACGAAAATCCTTCC
AACTATACTTCTGAGTGTGTGGCGATGGCGACATTTTGGGGCATTACAATGAAACAAATGGTCACTTGGAATCCA
AGTCTTGTGAACAACGCAAGCACCTGTGAGCTCAACAAGGAAAACAGCTACTGCATCCTGCGGTATGAAAACAGC
ACTGCCTCAACGGAGGATACTGATAGTGGGCTCTGCCTTCCCATGAATGCTACGGAGGCTGGAACGGCATTCAAC
TGCAATTGCTTCACCTCCGTCGACCTGTCTTACTCTGACGTATACACCTGCGACGACATCATTTACGATTACAGC
CTGACCATGGACGACCTTGTGTCCTGGAACAGCTGGCTGGAAGGAGACTGTGACACTGCGCTCTATGCCAGCCTA
AATGCCACGGATGACCGCGCCATCTGTATTGGTGTCGGGTCTGCAGCTGCAACGACTACAGCCAGTGGAACTGCC
ACCCAAACCCCCACCACCACCTCCTCCTCCTCTTCCATGGGGCCCACTCCAACCGACACTGTGTCGGGATGCGAG
AAGTTCTACACCACTACAAAGGGCGACGACTGTGCCACAGTCGAGACCAAGTTCAGCATCACCCTTGCTCAATTC
TATCAGTGGAACCCCAGTGTTGGCTCTACTTGTACCAATTTGTGGCTAGGAGAAGCATACTGTGTCAAGGGACCG
GCATCGACGACCAGCGCAACAGCAAGTGCACCCACTCAGACGGGAATCGCGTCGAACTGCAACCAGTATTACACG
GTGGTGTCGAACGATTCGTGCGCCAAGATCGAGACCGCGTATGGTATTACTTTTGCTGAACTATACAAGTGGAAT
CCTGCGATTGGATCGGACTGTGAGTATCTAGGAGTCGGGTACTCGGTGTGTGTGGGGGTTTCTTCATAG
Gene >Pro_DTO070G2_2|g7569.t1
ATGCGTGGGATGTGGACTGCCCCGTGGGCTCTACTAATTTCCACGGCCCTTGCCCAGCAGCCTGCTGGCATTCGA
GGATTCACAAGCTATCCTGGTCTCACCGATGGTTGCAAAGAAGCCTTGTCGACTAATGTGTCCTGTCCGGCATTT
CTGCCCGTTGTGTCCCCAGAGTAGGTCTGATTCATAAATTGCGGGCTCAAAGCTGATTTAAACAGCAACTCTCTT
CTGGATGGTGATCAAGTCGATGAACTTTGCGTCGACACCTGCTATAGTTCTTTGAAAAGCGCCAGAGCAACCATC
AAGGCGGCCTGCTCAGAGACCACCGATGTGATCGTCGTTGAGGATGTAGCTTATCCAGCTACATTTATCGCTGAC
AAGTACATGTTGACCTATGACATATCTTGTCGGAAAGATGAGTGAGTGGTGATTCTGCCAATGATTATCGATTCT
GACCATCATTAGGTCCGGGGGTTACTGTGACCCGCAATTGCTCTCCTGGTCCAACGGGTCTTGGCCTGTTAATGG
TTCTTGCTCGGATTGTTGGCTGGGGACATTAGAGACTCAATTAAACAGCCCCTTAGGGTATGATGAGGGCGTGGC
GGACAGCTTCACTTCTTTGACGTCGAGCTGCAGCGCCACGGGTTACTCAGTCACTTCCCCAACTGCGTACGCGCT
TAATGCAACTGCGACTGCAACCAGCTCGCCTGCAACCAGCTCGGCAACAACCAGCTGCGAAAACTATTATCAGGT
GAAGGAAACAGACGACTGTAACTCCGTGGCAAAGTCGCTGGGAGTCTCTACATACTACCTACTGCAAACCAACGA
CTTGGATCTCTACTGTCAAAACTTTGCGGCGAAAGTCAACCAGACACTCTGTGTCCCCTCGCAGTGCACCACACA
CACCTGGCAGGCTGATGACACTTGCGATAGTGTCGTCGGCGGCCTCGCGAATGTGACTCTTCCGCAGTTCTTCTC
CTGGAACCCCAATATCAATTCCCTCTGTCTGAATGCGATTTTCTTCATTGGATATGAGGTGTGTGTGAGGTGAGT
AGATTTCGCTTCAATCTCAATTTGAGAGTCACGGAATATTGACCTTTACAGTCCCCCGAGTGGCTACTTGAATCA
GACTGCTGGTGGATCCGACTCAAGCGCAACCGAAACTGGAGTAGCCACTGGCATTGCAGCGGTCCCAACAAATGC
TATGGACAATAGCAACCGCAACTGCAGCCAGTGGTATACGGTGAGTGATCCTTCCATCCAAGTTGGGTCTTTGCT
CATTTCTACTAGGTTCAAAAAGGCGATGAATGTGCCAAGGTCTCTCTCGCCCATTCTATCTCCCTTACCGACTTC
TACTTCCTGAACCCAGAAATCGACGCAAACTGCACAAACCTCCTGCTTGACGAGGCATACTGTGTTAAGGCCGTT
GGTTCAATCACCAGCTACGCAAACTACACGGTGACTGGAGTATTGCCCATCACCGTCACGCCCGTCAACTTCACC
AACGTGAATACTGACATACCTACGGCCACAAGCGATCCTGGCTATGTGTATACGGGAGCGGCGCTCCTTCCCACC
GCTTCGGGCACTATCCCAGACTGCTATGACTACGAAAATCCTTCCAACTATACTTCTGAGTGTGTGGCGATGGCG
ACATTTTGGGGCATTACAATGAAACAAATGGTCACTTGGAATCCAAGTCTTGTGAACAACGCAAGCACCTGTGAG
CTCAACAAGGAAAACAGCTACTGCATCCTGCGGTATGAAAACAGCACTGCCTGTAAGTACCGCTGGCTCGAACAA
ATAGATTAGGCTGACGCAGATGTAGCAACGGAGGATACTGATAGTGGGCTCTGCCTTCCCATGAATGCTACGGAG
GCTGGAACGGCATTCAACTGCAATTGCTTCACCTCCGTCGACCTGTCTTACTCTGACGGTATGATTTGACCCTCC
CCAATCGTGCTATTACTAATCAAATGCTAGTATACACCTGCGACGACATCATTTACGATTACAGCCTGACCATGG
ACGACCTTGTGTCCTGGAACAGCTGGCTGGAAGGAGACTGTGACACTGCGCTCTATGCCAGCCTAAATGCCACGG
ATGACCGCGCCATCTGTATTGGTGTCGGGTCTGCAGCTGCAACGACTACAGCCAGTGGAACTGCCACCCAAACCC
CCACCACCACCTCCTCCTCCTCTTCCATGGGGCCCACTCCAACCGACACTGTGTCGGGATGCGAGAAGTTCTACA
CCACTACAAAGGGCGACGACTGTGCCACAGTCGAGACCAAGTTCAGCATCACCCTTGCTCAATTCTATCAGTGGA
ACCCCAGTGTTGGCTCTACTTGTACCAATTTGTGGCTAGGAGAAGCATACTGTGTCAAGGGACCGGCATCGACGA
CCAGCGCAACAGCAAGTGCACCCACTCAGACGGGAATCGCGTCGAACTGCAACCAGTATTACACGGTGGTGTCGA
ACGATTCGTGCGCCAAGATCGAGACCGCGTATGGTATTACTTTTGCTGAACTATACAAGTGGAATCCTGCGATTG
GATCGGACTGTGAGTATCTAGGAGTCGGGTACTCGGTGTGTGTGGGGGTTTCTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail