Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7514.t1
Gene name
Locationscaffold_13:432075..436508
Strand+
Gene length (bp)4433
Transcript length (bp)4008
Coding sequence length (bp)4008
Protein length (aa) 1336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04762 IKI3 IKI3 family 0.0E+00 1 937

GO

GO Term Description Terminal node
GO:0002098 tRNA wobble uridine modification Yes
GO:0033588 elongator holoenzyme complex Yes
GO:0008150 biological_process No
GO:0006400 tRNA modification No
GO:0044238 primary metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0006399 tRNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006396 RNA processing No
GO:0002097 tRNA wobble base modification No
GO:0008152 metabolic process No
GO:0016070 RNA metabolic process No
GO:0008033 tRNA processing No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034470 ncRNA processing No
GO:0032991 protein-containing complex No
GO:0034660 ncRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009451 RNA modification No
GO:0006139 nucleobase-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup5954
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g6539.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g9835.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g5841.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g7549.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g7606.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g5164.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g4567.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g7035.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g54.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g7357.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g8041.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g9060.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g8473.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g5612.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g7025.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g5454.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g8028.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g1756.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g7514.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g9493.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g6420.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7623.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g9451.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g3636.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g3373.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g5578.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g7951.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g1834.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g4434.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g7178.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g6807.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g940.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g6889.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7179.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7514.t1
MRNLRSIRLAETEIESELPLTATAWDTASDSVVCTFGPAENNAIIEVRRKRPEITSTDPLSPEAFECIASWDAPC
PLPDLACDRVLALHYFADNLTTCLVLEGGDIIVVREEPLAGEDKIEIVGSVDVGITAAAWSPDEEMLALTTRAQT
FLYMTRDFENVADITFAHSDLQSSQHVSVGWGKKETQFQGKRAKALRDPTVPEKIDQGILSSQDDGSTTISWRGD
GAYVAVNSIEADTRRVIRVYSREGTLESVSEPVDGLEGALSWRPSGSLIAGIQRLENRVDVVFFEKNGLRHGEFS
LRLSDEEMKSWASRIHLSWNVDSTVLAVKFQDRVQFWTTGNYHWYLKQEIPITVDTNSSLPYSFEWHQEKTLRLV
AGSSVSILDADYVFDINHGSTSIPDDVGAVAVIDGKTLKLTPLRMAGVPPPMAHNELTLESKAIDVAFSKSGSRI
AVLTSNTLSVYLWSLKSRPVPVPILESSYPLSDAPASRPRQIAFLNENEVYVLKDNGPNSSHIERTMLDTRTTES
VYQAVDSEQLASIFAGIGHQALWFSHARQPAHPVSYSSVEESSSGNLDIASWGESPNVDSHWARVVSISEHERVL
IAMTRTGTLYANKRVLARNCTSFLVTPSHLLFTTSAHLLKFVHLNHVDEMEVPEDTPETDERCRSIERGSRLVSV
IPSIFAVVLQAPRGNIETIFPRALVLAGIRTFIDQKKYRSAFLACRSQMVDLNILHDYAPEQFMENITLFIDQVK
KIEFIDDFLSRLSEDDVSQTLYKDTLKISKNVSAAVAQPDGPAVPSVPKNGKKESKINKICGAFLAALQNRVDTN
LQNLITAHVCKSPPDMEAGLGLAAGLRIQHPEQAEDAIAHMCFLTDAHRLYSHALGVYDLELTLLVAQQAQMDPR
EYLPFLRKLQQLPETRRKFEIDNHLSRFEKALVHLYALNAHDEISAYVVKHVLYKEALELYKYQAEQQREITELY
ADYLQSQSKYKDAAIAYESLELYESAYKCFNLAHKWRESLYCAMMASLSEEDLAAHIDGLVTTLVDENKDYVAAA
TIYADHLHDIVTAARLLCRGSKFADAARLLTLHGKQSMVVEIVDSGLAEAMGNMTDLLADCRSQLNAQVPRLNEL
RQLRATDPLAFYGGDPAGGEAGVDIPDNVSLAPTDASTLAGRSMFTRYTGNTGKTGKTGMTRHTSKTRRREERKR
ARGKKGTVYEEEYLANSIRRLIERVNSSVAEAEILVDALLRRGMRERAAAVEKALQEVLAMCADCRDEVFEVPAP
NTANEDQEDEDNDVEPINPPVYGGGASVLRESIAIVEGGGAARVKEIPIVKEMKKSSLLA*
Coding >Pro_DTO070G2_2|g7514.t1
ATGCGCAATTTAAGAAGTATCCGTCTCGCTGAGACGGAAATTGAGAGCGAACTGCCTCTCACAGCTACAGCATGG
GATACTGCTTCAGACTCGGTGGTGTGCACCTTTGGTCCGGCCGAGAACAATGCAATCATTGAGGTTAGACGAAAA
CGCCCCGAGATCACTTCAACAGATCCACTGTCTCCCGAGGCTTTTGAGTGTATTGCTTCCTGGGATGCTCCGTGC
CCGCTGCCGGACCTGGCATGTGATCGTGTACTCGCCCTGCATTACTTTGCGGATAACCTGACAACCTGTCTGGTG
TTGGAAGGAGGTGATATTATCGTTGTTCGCGAAGAGCCACTTGCCGGCGAAGACAAGATTGAAATCGTCGGCTCA
GTCGATGTGGGAATCACGGCTGCAGCATGGTCACCAGATGAGGAAATGCTGGCTCTCACCACCAGAGCCCAGACG
TTCTTGTATATGACCAGAGACTTTGAGAATGTGGCCGATATTACTTTCGCCCACAGTGACCTGCAATCATCACAG
CATGTGTCAGTGGGATGGGGTAAAAAAGAAACTCAGTTTCAAGGAAAGAGAGCCAAAGCTCTTCGAGACCCGACT
GTACCGGAAAAGATCGACCAAGGAATTTTGAGTAGTCAAGATGATGGTAGCACTACAATCAGCTGGCGAGGGGAT
GGGGCGTATGTTGCTGTGAACAGCATCGAAGCAGATACTCGCCGTGTGATCAGGGTGTACTCGAGAGAGGGCACT
TTGGAGAGTGTGAGCGAACCTGTTGACGGTTTGGAAGGCGCATTGAGCTGGCGGCCATCTGGCAGCTTGATTGCT
GGAATTCAACGACTCGAAAATCGGGTCGATGTGGTGTTCTTCGAGAAAAACGGACTCCGCCACGGCGAGTTCTCT
CTTCGTCTGTCCGATGAGGAGATGAAATCATGGGCTTCTCGCATCCACCTTTCTTGGAATGTTGATTCTACTGTA
CTTGCTGTCAAGTTCCAGGACCGTGTACAGTTCTGGACAACGGGCAACTACCATTGGTATTTGAAGCAAGAGATC
CCTATCACTGTTGATACAAATTCTTCGCTTCCATATTCTTTCGAATGGCATCAAGAGAAGACATTGCGATTGGTC
GCTGGCTCCTCAGTCTCGATACTGGACGCGGATTATGTGTTTGATATCAACCATGGATCTACCTCCATTCCGGAT
GATGTTGGCGCTGTTGCAGTCATCGACGGGAAAACTCTCAAATTGACCCCGTTGCGAATGGCTGGAGTACCGCCT
CCCATGGCTCACAACGAGCTGACTTTAGAGTCCAAAGCCATTGATGTTGCATTCAGTAAATCCGGATCCCGTATT
GCTGTCCTGACGAGCAACACACTCTCCGTTTATCTCTGGTCTCTGAAGAGCCGACCCGTTCCTGTTCCTATCCTC
GAGTCAAGCTACCCGTTATCAGATGCCCCAGCCAGTCGACCCCGGCAGATTGCATTCTTGAATGAGAATGAGGTA
TATGTTCTCAAGGACAATGGACCGAACTCAAGCCATATCGAGAGGACGATGCTAGACACCCGAACCACCGAGTCT
GTATATCAGGCTGTAGACTCCGAGCAACTGGCATCGATCTTCGCCGGTATTGGACACCAAGCTCTGTGGTTCTCA
CATGCCCGCCAACCAGCCCATCCTGTCAGCTATTCGAGTGTTGAAGAATCTTCATCGGGAAATCTTGATATTGCT
TCATGGGGTGAGAGCCCCAATGTTGACAGCCATTGGGCCCGTGTTGTCTCTATCTCTGAGCATGAGCGCGTTTTG
ATTGCAATGACGAGAACTGGCACCTTGTATGCTAACAAGCGAGTCCTTGCGAGGAACTGCACGTCCTTCCTCGTG
ACCCCATCTCATCTTCTATTCACCACATCGGCACATCTTCTGAAGTTTGTTCATTTGAACCACGTTGATGAAATG
GAAGTTCCCGAGGATACACCAGAAACCGATGAACGGTGCAGAAGTATTGAACGTGGCTCTCGGTTGGTTTCGGTG
ATACCGTCGATTTTCGCAGTCGTACTTCAAGCTCCTCGAGGGAACATTGAGACCATCTTCCCTCGCGCTCTAGTA
TTGGCTGGAATCCGTACCTTCATTGACCAGAAGAAATACCGGTCTGCCTTCCTTGCATGTCGCAGTCAAATGGTG
GATCTAAACATTCTCCATGATTACGCTCCTGAACAATTCATGGAAAACATCACTCTGTTTATTGATCAAGTCAAG
AAGATTGAGTTTATTGATGATTTCCTATCACGCCTGTCGGAGGACGATGTGTCACAGACACTGTACAAAGACACG
CTGAAAATATCCAAGAACGTATCGGCAGCTGTCGCCCAGCCGGATGGACCAGCAGTTCCCTCGGTGCCCAAAAAT
GGCAAAAAGGAGAGCAAAATCAACAAAATATGTGGTGCATTCCTAGCCGCTCTCCAAAACCGTGTAGATACCAAT
TTGCAGAATCTGATCACGGCGCATGTTTGCAAATCACCGCCTGACATGGAGGCAGGACTGGGACTTGCTGCAGGA
CTAAGAATACAACATCCCGAGCAAGCTGAAGATGCTATTGCGCACATGTGTTTCTTAACCGATGCTCACCGGCTT
TACTCTCACGCATTGGGTGTATATGATCTTGAGCTTACATTGTTGGTTGCTCAACAAGCTCAGATGGATCCTCGC
GAATACCTACCATTCCTTCGTAAGCTACAGCAGCTCCCAGAGACTCGAAGGAAATTTGAGATCGACAATCACCTT
TCTCGCTTCGAAAAGGCTTTGGTGCATTTGTATGCTCTCAATGCTCACGATGAGATCAGCGCATATGTCGTCAAG
CATGTGTTGTATAAGGAAGCCCTTGAGCTCTACAAGTACCAAGCAGAGCAACAACGGGAAATCACCGAGCTCTAT
GCCGATTATCTACAAAGTCAATCGAAGTACAAAGACGCAGCAATTGCGTACGAGTCTCTCGAGCTTTATGAAAGT
GCTTACAAGTGCTTCAATCTGGCGCACAAATGGCGCGAGTCATTGTACTGCGCCATGATGGCATCTCTATCCGAG
GAAGATCTAGCTGCTCACATCGACGGTCTGGTCACAACCCTAGTTGACGAAAACAAGGACTACGTCGCGGCAGCA
ACAATCTACGCCGACCATTTGCATGACATCGTGACAGCCGCACGACTTCTCTGCAGGGGATCGAAGTTCGCCGAC
GCAGCACGTCTCCTTACACTACACGGTAAACAGAGCATGGTTGTCGAAATCGTTGACTCTGGCCTCGCGGAAGCA
ATGGGCAACATGACCGACCTGCTTGCCGACTGCAGATCTCAGCTCAATGCCCAGGTCCCACGACTCAACGAACTC
CGTCAGCTTCGCGCTACCGACCCGCTTGCTTTCTACGGTGGTGACCCCGCCGGTGGAGAGGCGGGCGTCGATATC
CCTGACAACGTCTCGCTGGCCCCGACAGATGCATCTACGCTTGCCGGTCGCTCCATGTTCACGCGTTACACGGGT
AACACCGGGAAAACAGGCAAAACTGGAATGACACGTCATACCTCGAAGACCCGCCGGCGCGAGGAACGCAAGCGT
GCTCGTGGTAAGAAGGGCACCGTTTATGAAGAGGAATATCTTGCCAACAGTATTCGACGACTCATTGAACGGGTT
AACTCGAGCGTAGCAGAAGCTGAGATCCTTGTCGATGCCCTGCTGCGTCGTGGCATGCGTGAGCGTGCAGCTGCT
GTCGAGAAGGCATTGCAGGAAGTCTTGGCTATGTGCGCGGATTGCCGGGACGAGGTATTTGAAGTCCCTGCCCCC
AATACAGCGAACGAGGACCAGGAGGATGAGGATAATGATGTCGAGCCCATCAACCCTCCTGTTTACGGAGGAGGT
GCCAGTGTTTTGAGAGAAAGTATAGCCATTGTTGAGGGTGGCGGTGCCGCTCGCGTCAAGGAGATCCCTATCGTC
AAAGAAATGAAGAAGTCTTCTTTGCTAGCTTGA
Transcript >Pro_DTO070G2_2|g7514.t1
ATGCGCAATTTAAGAAGTATCCGTCTCGCTGAGACGGAAATTGAGAGCGAACTGCCTCTCACAGCTACAGCATGG
GATACTGCTTCAGACTCGGTGGTGTGCACCTTTGGTCCGGCCGAGAACAATGCAATCATTGAGGTTAGACGAAAA
CGCCCCGAGATCACTTCAACAGATCCACTGTCTCCCGAGGCTTTTGAGTGTATTGCTTCCTGGGATGCTCCGTGC
CCGCTGCCGGACCTGGCATGTGATCGTGTACTCGCCCTGCATTACTTTGCGGATAACCTGACAACCTGTCTGGTG
TTGGAAGGAGGTGATATTATCGTTGTTCGCGAAGAGCCACTTGCCGGCGAAGACAAGATTGAAATCGTCGGCTCA
GTCGATGTGGGAATCACGGCTGCAGCATGGTCACCAGATGAGGAAATGCTGGCTCTCACCACCAGAGCCCAGACG
TTCTTGTATATGACCAGAGACTTTGAGAATGTGGCCGATATTACTTTCGCCCACAGTGACCTGCAATCATCACAG
CATGTGTCAGTGGGATGGGGTAAAAAAGAAACTCAGTTTCAAGGAAAGAGAGCCAAAGCTCTTCGAGACCCGACT
GTACCGGAAAAGATCGACCAAGGAATTTTGAGTAGTCAAGATGATGGTAGCACTACAATCAGCTGGCGAGGGGAT
GGGGCGTATGTTGCTGTGAACAGCATCGAAGCAGATACTCGCCGTGTGATCAGGGTGTACTCGAGAGAGGGCACT
TTGGAGAGTGTGAGCGAACCTGTTGACGGTTTGGAAGGCGCATTGAGCTGGCGGCCATCTGGCAGCTTGATTGCT
GGAATTCAACGACTCGAAAATCGGGTCGATGTGGTGTTCTTCGAGAAAAACGGACTCCGCCACGGCGAGTTCTCT
CTTCGTCTGTCCGATGAGGAGATGAAATCATGGGCTTCTCGCATCCACCTTTCTTGGAATGTTGATTCTACTGTA
CTTGCTGTCAAGTTCCAGGACCGTGTACAGTTCTGGACAACGGGCAACTACCATTGGTATTTGAAGCAAGAGATC
CCTATCACTGTTGATACAAATTCTTCGCTTCCATATTCTTTCGAATGGCATCAAGAGAAGACATTGCGATTGGTC
GCTGGCTCCTCAGTCTCGATACTGGACGCGGATTATGTGTTTGATATCAACCATGGATCTACCTCCATTCCGGAT
GATGTTGGCGCTGTTGCAGTCATCGACGGGAAAACTCTCAAATTGACCCCGTTGCGAATGGCTGGAGTACCGCCT
CCCATGGCTCACAACGAGCTGACTTTAGAGTCCAAAGCCATTGATGTTGCATTCAGTAAATCCGGATCCCGTATT
GCTGTCCTGACGAGCAACACACTCTCCGTTTATCTCTGGTCTCTGAAGAGCCGACCCGTTCCTGTTCCTATCCTC
GAGTCAAGCTACCCGTTATCAGATGCCCCAGCCAGTCGACCCCGGCAGATTGCATTCTTGAATGAGAATGAGGTA
TATGTTCTCAAGGACAATGGACCGAACTCAAGCCATATCGAGAGGACGATGCTAGACACCCGAACCACCGAGTCT
GTATATCAGGCTGTAGACTCCGAGCAACTGGCATCGATCTTCGCCGGTATTGGACACCAAGCTCTGTGGTTCTCA
CATGCCCGCCAACCAGCCCATCCTGTCAGCTATTCGAGTGTTGAAGAATCTTCATCGGGAAATCTTGATATTGCT
TCATGGGGTGAGAGCCCCAATGTTGACAGCCATTGGGCCCGTGTTGTCTCTATCTCTGAGCATGAGCGCGTTTTG
ATTGCAATGACGAGAACTGGCACCTTGTATGCTAACAAGCGAGTCCTTGCGAGGAACTGCACGTCCTTCCTCGTG
ACCCCATCTCATCTTCTATTCACCACATCGGCACATCTTCTGAAGTTTGTTCATTTGAACCACGTTGATGAAATG
GAAGTTCCCGAGGATACACCAGAAACCGATGAACGGTGCAGAAGTATTGAACGTGGCTCTCGGTTGGTTTCGGTG
ATACCGTCGATTTTCGCAGTCGTACTTCAAGCTCCTCGAGGGAACATTGAGACCATCTTCCCTCGCGCTCTAGTA
TTGGCTGGAATCCGTACCTTCATTGACCAGAAGAAATACCGGTCTGCCTTCCTTGCATGTCGCAGTCAAATGGTG
GATCTAAACATTCTCCATGATTACGCTCCTGAACAATTCATGGAAAACATCACTCTGTTTATTGATCAAGTCAAG
AAGATTGAGTTTATTGATGATTTCCTATCACGCCTGTCGGAGGACGATGTGTCACAGACACTGTACAAAGACACG
CTGAAAATATCCAAGAACGTATCGGCAGCTGTCGCCCAGCCGGATGGACCAGCAGTTCCCTCGGTGCCCAAAAAT
GGCAAAAAGGAGAGCAAAATCAACAAAATATGTGGTGCATTCCTAGCCGCTCTCCAAAACCGTGTAGATACCAAT
TTGCAGAATCTGATCACGGCGCATGTTTGCAAATCACCGCCTGACATGGAGGCAGGACTGGGACTTGCTGCAGGA
CTAAGAATACAACATCCCGAGCAAGCTGAAGATGCTATTGCGCACATGTGTTTCTTAACCGATGCTCACCGGCTT
TACTCTCACGCATTGGGTGTATATGATCTTGAGCTTACATTGTTGGTTGCTCAACAAGCTCAGATGGATCCTCGC
GAATACCTACCATTCCTTCGTAAGCTACAGCAGCTCCCAGAGACTCGAAGGAAATTTGAGATCGACAATCACCTT
TCTCGCTTCGAAAAGGCTTTGGTGCATTTGTATGCTCTCAATGCTCACGATGAGATCAGCGCATATGTCGTCAAG
CATGTGTTGTATAAGGAAGCCCTTGAGCTCTACAAGTACCAAGCAGAGCAACAACGGGAAATCACCGAGCTCTAT
GCCGATTATCTACAAAGTCAATCGAAGTACAAAGACGCAGCAATTGCGTACGAGTCTCTCGAGCTTTATGAAAGT
GCTTACAAGTGCTTCAATCTGGCGCACAAATGGCGCGAGTCATTGTACTGCGCCATGATGGCATCTCTATCCGAG
GAAGATCTAGCTGCTCACATCGACGGTCTGGTCACAACCCTAGTTGACGAAAACAAGGACTACGTCGCGGCAGCA
ACAATCTACGCCGACCATTTGCATGACATCGTGACAGCCGCACGACTTCTCTGCAGGGGATCGAAGTTCGCCGAC
GCAGCACGTCTCCTTACACTACACGGTAAACAGAGCATGGTTGTCGAAATCGTTGACTCTGGCCTCGCGGAAGCA
ATGGGCAACATGACCGACCTGCTTGCCGACTGCAGATCTCAGCTCAATGCCCAGGTCCCACGACTCAACGAACTC
CGTCAGCTTCGCGCTACCGACCCGCTTGCTTTCTACGGTGGTGACCCCGCCGGTGGAGAGGCGGGCGTCGATATC
CCTGACAACGTCTCGCTGGCCCCGACAGATGCATCTACGCTTGCCGGTCGCTCCATGTTCACGCGTTACACGGGT
AACACCGGGAAAACAGGCAAAACTGGAATGACACGTCATACCTCGAAGACCCGCCGGCGCGAGGAACGCAAGCGT
GCTCGTGGTAAGAAGGGCACCGTTTATGAAGAGGAATATCTTGCCAACAGTATTCGACGACTCATTGAACGGGTT
AACTCGAGCGTAGCAGAAGCTGAGATCCTTGTCGATGCCCTGCTGCGTCGTGGCATGCGTGAGCGTGCAGCTGCT
GTCGAGAAGGCATTGCAGGAAGTCTTGGCTATGTGCGCGGATTGCCGGGACGAGGTATTTGAAGTCCCTGCCCCC
AATACAGCGAACGAGGACCAGGAGGATGAGGATAATGATGTCGAGCCCATCAACCCTCCTGTTTACGGAGGAGGT
GCCAGTGTTTTGAGAGAAAGTATAGCCATTGTTGAGGGTGGCGGTGCCGCTCGCGTCAAGGAGATCCCTATCGTC
AAAGAAATGAAGAAGTCTTCTTTGCTAGCTTGA
Gene >Pro_DTO070G2_2|g7514.t1
ATGCGCAATTTAAGAAGTATCCGTCTCGCTGAGACGGAAATTGAGAGCGAACTGCCTCTCACAGCTACAGCATGG
GATACTGCTTCAGACTCGGTGGTGTGCACCTTTGGTCCGGCCGAGAACAATGCAATCATTGAGGTTAGACGAAAA
CGCCCCGAGATCACTTCAACAGATCCACTGTCTCCCGAGGCTTTTGAGTGTATTGCTTCCTGGGATGCTCCGTGC
CCGCTGCCGGACCTGGCATGTGATCGTGTACTCGCCCTGCATTACTTTGCGGATAACCTGACAACCTGTCTGGTG
TTGGAAGGAGGTGATATTATCGTTGTTCGCGAAGAGCCACTTGCCGGCGAAGACAAGATTGAAATCGTCGGCTCA
GTCGATGTGGGAATCACGGCTGCAGCATGGTCACCAGATGAGGAAATGCTGGCTCTCACCACCAGAGCCCAGACG
TTCTTGTATATGACCAGAGACTTTGAGAATGTGGCCGATATTACTTTCGCCCACAGTGACCTGCAATCATCACAG
CATGTGTCAGTGGGATGGGGTAAAAAAGAAACTCAGTTTCAAGGAAAGAGAGCCAAAGCTCTTCGAGACCCGACT
GTACCGGAAAAGATCGACCAAGGAATTTTGAGTAGTCAAGATGATGGTAGCACTACAATCAGCTGGCGAGGGGAT
GGGGCGTATGTTGCTGTGAACAGCATCGAAGCAGATACTCGCCGTGTGATCAGGGTGTACTCGAGAGAGGGCACT
TTGGAGAGTGTGAGCGAACCTGTTGACGGTTTGGAAGGCGCATTGAGCTGGCGGCCATCTGGCAGCTTGATTGCT
GGAATTCAACGACTCGAAAATCGGGTCGATGTGGTGTTCTTCGAGAAAAACGGACTCCGCCACGGCGAGTTCTCT
CTTCGTCTGTCCGATGAGGAGATGAAATCATGGGCTTCTCGCATCCACCTTTCTTGGAATGTTGATTCTACTGTA
CTTGCTGTCAAGTTCCAGGACCGTGTACAGTTCTGGACAACGGGCAACTACCATTGGTATTTGAAGCAAGAGATC
CCTATCACTGTTGATACAAATTCTTCGCTTCCATATTCTTTCGAATGGCATCAAGAGAAGACATTGCGATTGGTC
GCTGGCTCCTCAGGTATGCTATCCTTGCATGAAGAACAGAGCAAGAATAAAAGCTGATCTAAACAGTCTCGATAC
TGGACGCGGATTATGTGTTTGATATCAACCATGGATCTACCTCCATTCCGGATGATGTTGGCGCTGTTGCAGTCA
TCGACGGGAGTAAGTATCCAGTCAGACCTGATTTGAAACATTACTGATTCACCTATTAGAAACTCTCAAATTGAC
CCCGTTGCGAATGGCTGGAGTACCGCCTCCCATGGCTCACAACGAGCTGACTTTAGAGTCCAAAGCCATTGATGT
TGCATTCAGTAAATCCGGATCCCGTATTGCTGTCCTGACGAGCAACACACTCTCCGTTTATCTCTGGTCTCTGAA
GAGCCGACCCGTTCCTGTTCCTATCCTCGAGTCAAGCTACCCGTTATCAGATGCCCCAGCCAGTCGACCCCGGCA
GATTGCATTCTTGAATGAGAATGAGGTATATGTTCTCAAGGACAATGGACCGAACTCAAGCCATATCGAGAGGAC
GATGCTAGACACCCGAACCACCGAGTCTGTATATCAGGCTGTAGACTCCGAGCAACTGGCATCGATCTTCGCCGG
TATTGGACACCAAGCTCTGTGGTTCTCACATGCCCGCCAACCAGCCCATCCTGTCAGCTATTCGAGTGTTGAAGA
ATCTTCATCGGGAAATCTTGATATTGCTTCATGGGGTGAGAGCCCCAATGTTGACAGCCATTGGGCCCGTGTTGT
CTCTATCTCTGAGCATGAGGTAAGTCTATATTCGCTTTTTATTTGGAGCTTTGTGCTGATTTCGATAGCGCGTTT
TGATTGCAATGACGAGAACTGGCACCTTGTATGCTAACAAGCGAGTCCTTGCGAGGAACTGCACGTCCTTCCTCG
TGACCCCATCTCATCTTCTATTCACCACATCGGCACATCTTCTGAAGTTTGTTCATTTGAACCACGTTGATGGTA
AGATTGATTTCTTGGACGTCTAAGTCTTCATAAGCTAACATAGGGATTGCAGAAATGGAAGTTCCCGAGGATACA
CCAGAAACCGATGAACGGTGCAGAAGTATTGAACGTGGCTCTCGGTTGGTTTCGGTGATACCGTCGATTTTCGCA
GTCGTACTTCAAGCTCCTCGAGGGAACATTGAGACCATCTTCCCTCGCGCTCTAGTATTGGCTGGAATCCGTACC
TTCATTGACCAGAAGAAATACCGGTCTGCCTTCCTTGCATGTCGCAGTCAAATGGTGGATCTAAACATTCTCCAT
GATTACGCTCCTGAACAATTCATGGAAAACATCACTCTGTTTATTGATCAAGTCAAGAAGATTGAGTTTATTGAT
GATTTCCTATCACGCCTGTCGTACGTCAATATCCAGTCTTATAAGAAACTATTTTACTAACGTTCACATAGGGAG
GACGATGTGTCACAGACACTGTACAAAGACACGCTGAAAATATCCAAGAACGTATCGGCAGCTGTCGCCCAGCCG
GATGGACCAGCAGTTCCCTCGGTGCCCAAAAATGGCAAAAAGGAGAGCAAAATCAACAAAATATGTGGTGCATTC
CTAGCCGCTCTCCAAAACCGTGTAGATACCAATTTGCAGAATCTGATCACGGCGCATGTTTGCAAATCACCGCCT
GACATGGAGGCAGGACTGGGACTTGCTGCAGGACTAAGAAGTAAGTACTCGGTTCTTTGTCCTTCTCGATAATCA
AGAACTAACCATATCACAGTACAACATCCCGAGCAAGCTGAAGATGCTATTGCGCACATGTGTTTCTTAACCGAT
GCTCACCGGCTTTACTCTCACGCATTGGGTGTATATGATCTTGAGCTTACATTGTTGGTTGCTCAACAAGCTCAG
ATGGTAAGACTTTCGGATGAAGTCGTTGGCTGTGTTATTACTCAACACTAACGAATTCTCAGGATCCTCGCGAAT
ACCTACCATTCCTTCGTAAGCTACAGCAGCTCCCAGAGACTCGAAGGAAATTTGAGATCGACAATCACCTTTCTC
GCTTCGAAAAGGCTTTGGTGCATTTGTATGCTCTCAATGCTCACGATGAGATCAGCGCATATGTCGTCAAGCATG
TGTTGTATAAGGAAGCCCTTGAGCTCTACAAGTACCAAGCAGAGCAACAACGGGAAATCACCGAGCTCTATGCCG
ATTATCTACAAAGTCAATCGAAGTACAAAGACGCAGCAATTGGTCAGTGGTTTAATCAGCGCGACAAAATGACAG
CTAGCTAATTTTCAACCCCAGCGTACGAGTCTCTCGAGCTTTATGAAAGTGCTTACAAGTGCTTCAATCTGGCGC
ACAAATGGCGCGAGTCATTGTACTGCGCCATGATGGCATCTCTATCCGAGGAAGATCTAGCTGCTCACATCGACG
GTCTGGTCACAACCCTAGTTGACGAAAACAAGGACTACGTCGCGGCAGCAACAATCTACGCCGACCATTTGCATG
ACATCGTGACAGCCGCACGACTTCTCTGCAGGGGATCGAAGTTCGCCGACGCAGCACGTCTCCTTACACTACACG
GTAAACAGAGCATGGTTGTCGAAATCGTTGACTCTGGCCTCGCGGAAGCAATGGGCAACATGACCGACCTGCTTG
CCGACTGCAGATCTCAGCTCAATGCCCAGGTCCCACGACTCAACGAACTCCGTCAGCTTCGCGCTACCGACCCGC
TTGCTTTCTACGGTGGTGACCCCGCCGGTGGAGAGGCGGGCGTCGATATCCCTGACAACGTCTCGCTGGCCCCGA
CAGATGCATCTACGCTTGCCGGTCGCTCCATGTTCACGCGTTACACGGGTAACACCGGGAAAACAGGCAAAACTG
GAATGACACGTCATACCTCGAAGACCCGCCGGCGCGAGGAACGCAAGCGTGCTCGTGGTAAGAAGGGCACCGTTT
ATGAAGAGGAATATCTTGCCAACAGTATTCGACGACTCATTGAACGGGTTAACTCGAGCGTAGCAGAAGCTGAGA
TCCTTGTCGATGCCCTGCTGCGTCGTGGCATGCGTGAGCGTGCAGCTGCTGTCGAGAAGGCATTGCAGGAAGTCT
TGGCTATGTGCGCGGATTGCCGGGACGAGGTATTTGAAGTCCCTGCCCCCAATACAGCGAACGAGGACCAGGAGG
ATGAGGATAATGATGTCGAGCCCATCAACCCTCCTGTTTACGGAGGAGGTGCCAGTGTTTTGAGAGAAAGTATAG
CCATTGTTGAGGGTGGCGGTGCCGCTCGCGTCAAGGAGATCCCTATCGTCAAAGAAATGAAGAAGTCTTCTTTGC
TAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail