Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7418.t1
Gene name
Locationscaffold_13:191517..193165
Strand-
Gene length (bp)1648
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.2E-13 323 366
PF17123 zf-RING_11 RING-like zinc finger 7.8E-11 324 351
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.9E-08 324 365
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 5.5E-08 324 365

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7418.t1
MGLFLFFLLFFSVQAEVVSLPSNTTVRIQSTGFRIEGSTLTGQNLVPLTNSLIQSTDDKLKAFNVSGVVTRVIPS
NSLDLKSSQIAFISCDQDEYTGNIRVGQTIEYVTSGSAAILLYSKTAIGCNLTSNDPIANRYPNIFTFTSQGGYS
ALLRAFDNTTTISIVSMSYLSGVPSDSDSGGTGDSPNTAMIILYSITGIITALFLGIIITGAVRAHRHPERYGPR
RIAGRVRQSRARGIARAMLDTIPVVKFDEKNDDVEAAKRDVEMTISPEDREHSEPQADGHTEISTLHESEMPTPD
DNERPTPTAPEAKTEVHDGGNFSCPICTDDFVKGQDLRVLPCNHQFHVECIDPWLMNVSGTCPLCRIDLNPPQPE
NPEEENADQPGQPAEGGPNQTAEEAHRHTHRRLTNYLHGPLNARRMRDATVEERLAALRHVREASQGEPAPEGEA
HRGLTTRLRDRFRIRTRAHGAEAETPADADTAPSPAAPATVHLTPSTA*
Coding >Pro_DTO070G2_2|g7418.t1
ATGGGACTGTTTCTTTTCTTTCTCCTGTTCTTCTCAGTCCAGGCTGAGGTTGTTTCGCTACCATCAAATACCACC
GTCCGGATCCAATCCACCGGGTTTCGCATTGAGGGAAGCACTCTGACTGGTCAGAATCTGGTCCCCTTAACCAAC
TCGCTGATTCAATCAACCGACGACAAACTCAAGGCCTTTAATGTGTCCGGCGTTGTCACTCGAGTCATCCCCAGC
AATTCGCTCGACTTGAAGAGCTCGCAGATCGCTTTCATATCTTGCGACCAGGACGAGTATACCGGGAATATCCGC
GTTGGCCAGACAATTGAATACGTCACCTCTGGATCCGCTGCCATTCTACTATACAGCAAAACAGCTATCGGCTGC
AATCTCACCTCCAATGATCCGATTGCTAACCGGTATCCCAACATCTTTACTTTCACCAGCCAAGGCGGCTACTCT
GCACTACTCCGTGCTTTCGATAACACAACAACGATCAGCATCGTCTCAATGTCGTACCTCTCTGGTGTCCCATCC
GACAGTGATTCCGGTGGTACGGGCGACAGCCCGAACACTGCGATGATCATCCTGTACAGCATCACCGGTATCATC
ACGGCCCTGTTCCTGGGCATCATTATCACGGGTGCAGTCCGTGCTCATCGCCACCCCGAGCGATACGGCCCTCGC
CGGATTGCCGGGCGAGTCCGGCAAAGTCGAGCCCGAGGTATAGCTCGAGCCATGTTAGACACGATACCGGTCGTC
AAGTTTGATGAAAAAAATGATGACGTCGAGGCGGCCAAAAGAGATGTCGAGATGACCATAAGCCCTGAGGATCGC
GAGCACTCCGAGCCTCAGGCCGATGGTCACACGGAGATATCGACCCTCCACGAATCCGAAATGCCAACCCCAGAC
GATAATGAGCGCCCCACCCCCACAGCCCCCGAAGCCAAGACCGAGGTGCATGACGGAGGTAACTTCTCGTGTCCG
ATTTGCACGGATGACTTTGTCAAGGGCCAAGACCTACGTGTACTACCTTGTAATCACCAATTCCACGTGGAATGC
ATTGACCCGTGGTTAATGAACGTGTCCGGCACATGTCCACTCTGCCGCATCGACCTGAACCCACCCCAACCCGAG
AATCCAGAGGAAGAGAACGCCGACCAACCCGGTCAACCCGCAGAAGGCGGACCAAACCAAACAGCGGAAGAAGCC
CACCGCCATACTCACCGTCGTCTCACCAACTACCTCCACGGCCCCCTCAACGCCCGACGAATGCGCGATGCCACC
GTCGAGGAGCGTCTCGCCGCGCTCCGACACGTCCGCGAAGCAAGCCAAGGGGAACCTGCGCCCGAAGGAGAAGCA
CACCGTGGCCTGACTACCCGACTCCGCGATCGCTTCCGCATCCGAACCCGCGCCCACGGTGCTGAGGCTGAGACA
CCCGCGGACGCCGACACTGCGCCTTCTCCGGCGGCTCCAGCGACCGTCCATCTCACGCCGTCTACTGCATGA
Transcript >Pro_DTO070G2_2|g7418.t1
ATGGGACTGTTTCTTTTCTTTCTCCTGTTCTTCTCAGTCCAGGCTGAGGTTGTTTCGCTACCATCAAATACCACC
GTCCGGATCCAATCCACCGGGTTTCGCATTGAGGGAAGCACTCTGACTGGTCAGAATCTGGTCCCCTTAACCAAC
TCGCTGATTCAATCAACCGACGACAAACTCAAGGCCTTTAATGTGTCCGGCGTTGTCACTCGAGTCATCCCCAGC
AATTCGCTCGACTTGAAGAGCTCGCAGATCGCTTTCATATCTTGCGACCAGGACGAGTATACCGGGAATATCCGC
GTTGGCCAGACAATTGAATACGTCACCTCTGGATCCGCTGCCATTCTACTATACAGCAAAACAGCTATCGGCTGC
AATCTCACCTCCAATGATCCGATTGCTAACCGGTATCCCAACATCTTTACTTTCACCAGCCAAGGCGGCTACTCT
GCACTACTCCGTGCTTTCGATAACACAACAACGATCAGCATCGTCTCAATGTCGTACCTCTCTGGTGTCCCATCC
GACAGTGATTCCGGTGGTACGGGCGACAGCCCGAACACTGCGATGATCATCCTGTACAGCATCACCGGTATCATC
ACGGCCCTGTTCCTGGGCATCATTATCACGGGTGCAGTCCGTGCTCATCGCCACCCCGAGCGATACGGCCCTCGC
CGGATTGCCGGGCGAGTCCGGCAAAGTCGAGCCCGAGGTATAGCTCGAGCCATGTTAGACACGATACCGGTCGTC
AAGTTTGATGAAAAAAATGATGACGTCGAGGCGGCCAAAAGAGATGTCGAGATGACCATAAGCCCTGAGGATCGC
GAGCACTCCGAGCCTCAGGCCGATGGTCACACGGAGATATCGACCCTCCACGAATCCGAAATGCCAACCCCAGAC
GATAATGAGCGCCCCACCCCCACAGCCCCCGAAGCCAAGACCGAGGTGCATGACGGAGGTAACTTCTCGTGTCCG
ATTTGCACGGATGACTTTGTCAAGGGCCAAGACCTACGTGTACTACCTTGTAATCACCAATTCCACGTGGAATGC
ATTGACCCGTGGTTAATGAACGTGTCCGGCACATGTCCACTCTGCCGCATCGACCTGAACCCACCCCAACCCGAG
AATCCAGAGGAAGAGAACGCCGACCAACCCGGTCAACCCGCAGAAGGCGGACCAAACCAAACAGCGGAAGAAGCC
CACCGCCATACTCACCGTCGTCTCACCAACTACCTCCACGGCCCCCTCAACGCCCGACGAATGCGCGATGCCACC
GTCGAGGAGCGTCTCGCCGCGCTCCGACACGTCCGCGAAGCAAGCCAAGGGGAACCTGCGCCCGAAGGAGAAGCA
CACCGTGGCCTGACTACCCGACTCCGCGATCGCTTCCGCATCCGAACCCGCGCCCACGGTGCTGAGGCTGAGACA
CCCGCGGACGCCGACACTGCGCCTTCTCCGGCGGCTCCAGCGACCGTCCATCTCACGCCGTCTACTGCATGA
Gene >Pro_DTO070G2_2|g7418.t1
ATGGGACTGTTTCTTTTCTTTCTCCTGTTCTTCTCAGTCCAGGCTGAGGTTGTTTCGCTACCATCAAATACCACC
GTCCGGATCCAATCCACCGGGTTTCGCATTGAGGGAAGCACTCTGACTGGTCAGAATCTGGTCCCCTTAACCAAC
TCGCTGATTCAATCAACCGACGACAAACTCAAGGTGCCATACGCTCTTATCGTCCGTGGGGGCACCACTGACTAC
TTCAGGCCTTTAATGTGTCCGGCGTTGTCACTCGAGTCATCCCCAGCAATTCGCTCGACTTGAAGAGCTCGCAGA
TCGCTTTCATATCTTGCGACCAGGACGAGTATACCGGGAATATCCGCGTTGGCCAGACAATTGAATACGTCACCT
CTGGATCCGCTGCCATTCTACTATACAGCAAAACAGCTATCGGCTGCAATCTCACCTCCAATGATCCGATTGCTA
ACCGGTATCCCAACATCTTTACTTTCACCAGCCAAGGCGGCTACTCTGCACTACTCCGTGCTTTCGATAACACAA
CAACGATCAGCATCGTCTCAATGTCGTACCTCTCTGGTGTCCCATCCGACAGTGATTCCGGTGGTACGGGCGACA
GCCCGAACACTGGTTTGTATCCCGACTTCTTCTATCCTGCTCGGTCCGTTGACTTTTTCCAGCGATGATCATCCT
GTACAGCATCACCGGTATCATCACGGCCCTGTTCCTGGGCATCATTATCACGGGTGCAGTCCGTGCTCATCGCCA
CCCCGAGCGATACGGCCCTCGCCGGATTGCCGGGCGAGTCCGGCAAAGTCGAGCCCGAGGTATAGCTCGAGCCAT
GTTAGACACGATACCGGTCGTCAAGTTTGATGAAAAAAATGATGACGTCGAGGCGGCCAAAAGAGATGTCGAGAT
GACCATAAGCCCTGAGGATCGCGAGCACTCCGAGCCTCAGGCCGATGGTCACACGGAGATATCGACCCTCCACGA
ATCCGAAATGCCAACCCCAGACGATAATGAGCGCCCCACCCCCACAGCCCCCGAAGCCAAGACCGAGGTGCATGA
CGGAGGTAACTTCTCGTGTCCGATTTGCACGGATGACTTTGTCAAGGGCCAAGACCTACGTGTACTACCTTGTAA
TCACCAATTCCACGTGGAATGCATTGACCCGTGGTTAATGAACGTGTCCGGCACATGTCCACTCTGGTATGTCGA
TATGATAACTTATCAACTATCAACACCCAGACTAACCAATCACAGCCGCATCGACCTGAACCCACCCCAACCCGA
GAATCCAGAGGAAGAGAACGCCGACCAACCCGGTCAACCCGCAGAAGGCGGACCAAACCAAACAGCGGAAGAAGC
CCACCGCCATACTCACCGTCGTCTCACCAACTACCTCCACGGCCCCCTCAACGCCCGACGAATGCGCGATGCCAC
CGTCGAGGAGCGTCTCGCCGCGCTCCGACACGTCCGCGAAGCAAGCCAAGGGGAACCTGCGCCCGAAGGAGAAGC
ACACCGTGGCCTGACTACCCGACTCCGCGATCGCTTCCGCATCCGAACCCGCGCCCACGGTGCTGAGGCTGAGAC
ACCCGCGGACGCCGACACTGCGCCTTCTCCGGCGGCTCCAGCGACCGTCCATCTCACGCCGTCTACTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail