Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7397.t1
Gene name
Locationscaffold_13:139338..146648
Strand+
Gene length (bp)7310
Transcript length (bp)5820
Coding sequence length (bp)5820
Protein length (aa) 1940

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02636 Methyltransf_28 Putative S-adenosyl-L-methionine-dependent methyltransferase 8.8E-81 1534 1865
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 1.4E-43 516 858
PF01476 LysM LysM domain 1.2E-03 308 346

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7397.t1
MPWTILWTAVAPVLCVLLSLGTPASALSTHSERLAAALNAPGAFQSQLKPCPAPCASHEPQHWTVYASFDRLSFC
HEPILFDIAIHTPVNDFSKTLKFRACTTGDGWDESRNAGTISGTVYAGPSVRESKVTLQVAQQKSAGAAEGTSED
VITVLTQVQAYLHAGMDCTKNIMLGYYKGVVVGVYAGQALGKATASSVMGQVLSKFKGAAPATTLTQLCGDQRDA
DHVFGIATSTVADLSAVQAALVSWSQGKCESGLGDATSLPNVSIWEVPQHPVGRNNTTTSDPTGQELDAPLLART
AKYCKKRTVVSGDICQSLAKACGITLDQFYKYNSKEMCSNLKIGSSVCCTDGFLKPQPYDNGTCYTYTTQTGDTC
YDIGLAWSLTAKDLGKFNDGTTWGWNGCDNLGHSQNICLSSGHPPIPAVLPNAICGPQVPGTILDSPFTNASEFA
LLNPCPLNSCCNIWGQCGIDSSFCTLSTGPTRNPGTSKPGIYGCISNCGTGIVNNHDGPSGGYQRVGYYEAFNWD
RKCLHMRAQWSNTLDYTHMHWAFGSIGEDLSVYVNDSHSQWSGFMDLKDVKKIVSFGGWGFSTDVSTYDILRKAM
APDNRHKFISNLVAFANRTGIDGIDIDWEYPGAPDIPGIPPGLNTDAPNYLATLKALRQELPDKYSISIAAPASY
WYLKAFPISDIAKIVDYIVYMAYDLHGQWDYGNMYTQSGCKSGNCLRSHVNQTEVLLALAMITKAGVHSNKIMVG
ESSYGRSFKMAKQGCTGPDCFFTGTNETSNAKPGRCTGTGGYISNAEIKEIISHGGESVKTWYDKDTASDYVVYE
NDQWVAYMSYNTKQARRDTWKKLNFLGTIDWAVDLQDFNVADTVGPTGDYNKSSCINVFDNMIWNWVNPVIDAPV
GCTNLIQASPLATTVTRTAYTTITLVSGGTVSTTIVSTAFLVSEVDYQPFTIASSDTENGTIITYNPIPRVTPSP
MGIQVPKGWAITSPDGEVDGPSTTTDLVGLPTTTTTTTTDAEGFIVYITWQPTVSYSLPSFVTPKIPAPTIPDDD
NSPTPIPDPGVTDCIGDACTKGPDCTDSDCTRGGDCTGPGCTRGGDCTGPKCVRGGVCTGHNCEEGGRCSSDHCV
SGGGCSGAKCNKGGGCSGAKCNKGGGCVKTLLNNCSPGPCVGPSCIDMSCPWCDNGITITVQPGGNPAPTPRPTC
LNNCPTLPSCAGGATSCNEPCNINRCPANSMPTGKACTSFTTASDCTVIISSTAVHTTPTRSFSTTTRTRCETVI
DCDVQDMTVTTTITTSEVPDAIASPTGIYDYENDSHYNQAVFAAVASDYDEWERTADTTTTTTTTTTTSSTPTTT
TSTSSPNPNYPNEFMILKYEVHTVYFDLSEKHSYSWSGDYYAYNQDSTTENVCTNSYRVTGPIDAGASDDYPASL
GTFDLPAQYTGCKYSGSTDSVGPRNPVLLRCPGRWNSTFEQREWSTPLAKTLASVMRVTGPVPIAAFMRQVLTSP
DGGYYTTRGEGGGVFGKNGDFVTSPEISQVFGELIGIWTIAEWMAQGRTKSGVQLMEVGPGKGTLMDDMLRTFRN
FKSFSSSVEAIYLVEASGTLREVQKRLLCGEKAVMEETDIGHRSVCKYFDVPIVWVEDIRLLPHEEGKTPFIFAH
EFFDALPIHAFESVPPSPENQIANEPRKIMTPTGPVELHNPPKHANTPQWRELMVTLNPKAVEENIKGEPEFQLT
KAKASTPSSLVIPEISQRYRALKSQPGATIEISPESRIYAADFARRIGGDSASALAAKKTSPSSPPPSSQKKTPS
GAALIMDYGTLSTIPINSLRGIKSHKKVPPLSEPGRVDVSADVDFTSLAEAAIEGSDGVEVHGPVEQGDFLAAMG
IEERMQQLLRKVQDEEHKKTLETAWKRLVEKSGGSMGQIYKVMAIIPENGGQRRPVGFGGGIQM*
Coding >Pro_DTO070G2_2|g7397.t1
ATGCCGTGGACGATTCTTTGGACGGCGGTAGCACCGGTCCTCTGTGTATTACTATCACTCGGCACACCGGCCTCG
GCTTTGAGTACCCACTCTGAACGCCTAGCTGCAGCTCTGAATGCCCCGGGTGCGTTCCAGTCGCAGCTCAAACCA
TGTCCAGCGCCGTGTGCTAGCCACGAGCCCCAGCACTGGACTGTCTATGCTTCCTTTGACCGGCTCTCCTTCTGC
CATGAGCCAATTCTTTTCGATATCGCCATTCACACTCCTGTGAATGACTTTTCTAAGACGCTAAAGTTTCGCGCC
TGCACCACAGGTGATGGCTGGGATGAGTCCAGGAATGCCGGTACAATTAGTGGAACGGTCTATGCGGGCCCCTCC
GTTCGGGAGTCCAAGGTGACGCTACAGGTTGCACAACAGAAATCTGCAGGAGCAGCTGAAGGCACCAGTGAGGAT
GTAATCACCGTGCTCACGCAGGTTCAGGCATACCTCCACGCAGGGATGGACTGCACCAAGAATATTATGCTGGGT
TACTACAAGGGGGTGGTTGTCGGCGTGTATGCCGGCCAGGCATTGGGTAAAGCTACAGCTTCATCTGTGATGGGC
CAGGTCCTCTCCAAGTTCAAGGGAGCGGCTCCCGCGACCACGCTTACACAGCTCTGCGGTGATCAGCGTGACGCA
GACCATGTCTTTGGTATTGCCACTTCAACCGTAGCGGACCTTTCTGCTGTGCAGGCCGCACTGGTATCATGGAGT
CAAGGGAAATGTGAGAGCGGACTCGGCGACGCGACCTCACTCCCGAATGTCAGTATCTGGGAGGTACCGCAACAT
CCAGTCGGAAGGAACAATACCACAACTTCAGATCCTACCGGTCAGGAACTTGATGCGCCCCTCCTCGCTCGCACA
GCCAAATACTGCAAAAAAAGGACGGTTGTCTCGGGTGACATCTGCCAGTCTCTAGCCAAGGCGTGCGGTATCACC
CTCGACCAGTTCTACAAGTACAACTCCAAGGAAATGTGTTCGAACCTGAAGATTGGCTCGAGTGTCTGCTGCACC
GACGGGTTCCTGAAGCCACAGCCTTACGATAACGGCACCTGCTATACATACACGACACAGACCGGTGATACATGC
TACGATATCGGCCTTGCCTGGAGTCTGACGGCCAAAGACCTTGGGAAATTTAACGATGGCACCACATGGGGCTGG
AACGGCTGCGACAACCTGGGTCACAGTCAGAACATATGTCTCAGCTCGGGACACCCCCCGATCCCGGCCGTTCTG
CCCAACGCTATCTGTGGGCCGCAAGTGCCCGGCACGATCTTGGACAGCCCTTTCACCAACGCCTCGGAATTTGCC
TTGCTGAACCCGTGCCCACTGAACTCGTGCTGCAACATCTGGGGCCAGTGCGGGATTGACTCAAGCTTTTGCACC
CTGTCCACCGGCCCCACGCGGAATCCGGGCACATCGAAGCCGGGAATATACGGCTGCATCTCGAACTGTGGTACC
GGCATTGTTAATAATCATGACGGTCCTTCGGGTGGCTACCAGCGCGTGGGCTACTATGAGGCGTTCAACTGGGAC
CGTAAATGTCTGCACATGCGTGCACAGTGGTCCAACACACTTGACTACACCCACATGCACTGGGCGTTTGGTTCT
ATTGGTGAGGACCTGTCTGTATACGTTAATGACTCGCACAGCCAGTGGTCCGGCTTTATGGATCTGAAAGACGTA
AAGAAGATAGTTTCCTTTGGGGGATGGGGTTTCTCGACGGATGTGTCAACCTACGACATCCTTCGCAAAGCCATG
GCCCCTGACAATCGCCACAAGTTCATCTCCAACCTCGTTGCCTTTGCCAATAGAACGGGTATAGACGGAATCGAC
ATTGACTGGGAGTATCCTGGGGCGCCTGATATCCCCGGAATCCCCCCTGGCCTCAATACAGATGCTCCCAACTAC
CTAGCGACGCTCAAGGCACTACGACAGGAGCTACCAGACAAATATTCCATTTCCATTGCCGCTCCAGCTTCATAC
TGGTATCTCAAAGCGTTCCCCATTAGCGATATTGCGAAAATTGTCGACTACATTGTTTACATGGCTTACGATCTA
CATGGCCAGTGGGATTATGGCAACATGTACACGCAGTCAGGATGCAAAAGTGGCAACTGTCTTCGCAGTCATGTT
AATCAGACTGAAGTGCTTCTGGCACTTGCTATGATTACCAAAGCAGGTGTGCATTCTAACAAGATAATGGTGGGT
GAGTCGAGTTACGGAAGATCCTTCAAGATGGCCAAACAGGGTTGCACAGGACCAGACTGCTTTTTCACTGGCACA
AATGAGACCTCCAATGCGAAGCCAGGTCGATGCACCGGTACCGGGGGCTATATCTCGAACGCGGAAATCAAGGAG
ATTATTTCGCATGGCGGTGAATCGGTCAAGACCTGGTACGACAAGGACACGGCCTCTGACTACGTAGTCTATGAG
AATGATCAATGGGTAGCTTACATGAGTTATAACACCAAGCAGGCGCGAAGGGACACATGGAAGAAACTTAATTTC
CTGGGGACGATTGACTGGGCGGTTGATCTCCAAGACTTCAATGTGGCTGACACCGTCGGTCCTACGGGAGACTAC
AACAAGTCGTCGTGCATCAATGTCTTCGACAACATGATCTGGAACTGGGTCAACCCGGTCATTGATGCCCCCGTC
GGGTGCACAAATCTTATCCAAGCGTCCCCATTGGCGACAACGGTGACCCGCACGGCATACACCACGATCACGCTG
GTGTCCGGGGGCACCGTCAGCACTACCATTGTGTCTACTGCCTTCCTCGTTTCTGAGGTCGATTACCAGCCGTTT
ACGATCGCCTCCTCGGATACGGAGAATGGGACCATCATCACATACAATCCCATCCCGCGTGTGACGCCGAGCCCC
ATGGGGATTCAGGTGCCGAAAGGGTGGGCGATCACTTCGCCCGACGGCGAGGTGGATGGTCCGTCCACCACCACA
GACTTGGTTGGTCTTCCCACCACCACCACCACCACCACCACCGATGCAGAAGGGTTCATAGTCTACATTACATGG
CAGCCCACGGTAAGCTACAGCCTGCCATCATTCGTCACACCCAAAATCCCTGCACCCACCATCCCTGACGACGAC
AACTCTCCCACCCCCATACCTGATCCAGGAGTAACCGACTGTATCGGTGATGCCTGCACTAAGGGGCCTGATTGC
ACCGACAGCGACTGTACACGCGGTGGAGACTGTACCGGCCCCGGCTGTACCCGCGGCGGCGACTGCACCGGTCCA
AAGTGCGTCCGGGGCGGAGTATGTACAGGCCACAACTGCGAGGAAGGGGGTCGCTGCTCAAGCGATCACTGCGTC
TCGGGTGGTGGGTGCTCGGGTGCCAAATGCAACAAGGGGGGCGGATGCTCAGGTGCCAAATGCAACAAGGGTGGC
GGCTGTGTGAAAACCTTACTGAATAATTGCAGCCCGGGACCCTGCGTCGGTCCGTCTTGCATTGATATGAGCTGT
CCGTGGTGCGACAACGGTATTACCATCACGGTTCAGCCTGGGGGGAATCCTGCGCCTACACCCAGGCCTACCTGT
CTGAACAACTGCCCGACATTACCTTCCTGCGCGGGCGGCGCCACATCGTGCAACGAGCCGTGCAACATCAATCGC
TGCCCCGCGAACAGCATGCCGACCGGAAAGGCCTGCACGAGCTTCACCACTGCCAGTGACTGCACGGTAATTATC
AGCAGCACGGCAGTCCATACCACCCCGACGAGGAGCTTCTCGACCACCACGCGAACTCGTTGCGAGACGGTGATC
GACTGCGACGTGCAAGATATGACAGTCACAACCACCATCACCACCAGCGAGGTCCCGGACGCAATTGCCTCCCCA
ACGGGGATATACGACTACGAGAACGACTCTCACTATAATCAGGCTGTGTTTGCAGCCGTTGCATCCGACTACGAT
GAGTGGGAAAGGACCGCAGACACCACCACGACCACGACCACGACTACGACAACCAGTAGCACACCTACGACTACC
ACTTCAACCTCAAGTCCTAACCCTAACTACCCGAATGAGTTCATGATATTGAAGTACGAGGTTCACACGGTATAC
TTTGATTTGAGTGAGAAGCACTCCTACTCTTGGTCCGGTGACTACTACGCCTACAATCAGGATTCGACAACCGAG
AACGTATGCACCAACTCCTACCGTGTAACTGGCCCTATCGACGCGGGCGCTAGTGATGATTATCCTGCATCACTG
GGTACTTTTGATCTCCCTGCACAGTACACGGGCTGCAAGTACTCCGGAAGTACCGACTCTGTAGGACCTCGCAAC
CCAGTACTTCTGAGATGCCCAGGGAGATGGAACTCCACATTTGAACAGAGAGAATGGTCCACGCCGCTGGCAAAA
ACATTGGCCAGTGTCATGAGGGTCACAGGTCCCGTACCAATCGCGGCGTTCATGCGTCAGGTATTGACTTCCCCA
GATGGCGGATATTATACAACTCGAGGGGAGGGCGGAGGTGTCTTCGGCAAAAATGGTGATTTCGTAACGTCGCCC
GAGATCTCGCAAGTCTTTGGAGAGTTGATCGGTATATGGACTATCGCGGAGTGGATGGCGCAGGGGCGGACAAAG
AGTGGTGTTCAGCTGATGGAGGTTGGTCCAGGAAAAGGAACTTTGATGGATGATATGCTACGGACTTTCCGAAAC
TTCAAGAGCTTTTCTTCGAGTGTTGAAGCTATTTACCTTGTGGAAGCTAGTGGAACTCTCCGAGAAGTGCAGAAG
CGGTTGCTGTGCGGCGAGAAGGCTGTGATGGAGGAGACAGATATCGGCCATCGGAGTGTGTGCAAGTACTTCGAT
GTACCCATCGTCTGGGTGGAGGATATTCGTCTTCTACCGCATGAGGAAGGCAAGACACCCTTCATCTTCGCACAT
GAATTCTTCGACGCGCTTCCAATTCACGCATTCGAATCTGTTCCACCATCACCAGAGAACCAGATTGCCAACGAG
CCAAGGAAGATCATGACTCCCACTGGCCCAGTAGAACTACATAATCCGCCCAAACACGCAAACACCCCGCAATGG
CGTGAGCTAATGGTGACATTAAATCCAAAAGCCGTGGAAGAGAACATAAAAGGAGAGCCCGAGTTTCAATTAACC
AAAGCCAAAGCTTCCACGCCGTCATCGCTAGTGATCCCGGAGATCTCCCAGCGTTACCGAGCACTGAAGTCGCAG
CCAGGCGCGACCATCGAGATCAGCCCCGAGAGCCGAATCTATGCTGCAGACTTTGCGCGCCGGATCGGTGGTGAC
TCTGCTTCTGCGCTTGCTGCTAAAAAGACCTCTCCCTCTAGCCCACCGCCGTCATCTCAGAAAAAGACTCCATCT
GGCGCAGCCCTGATCATGGACTACGGGACATTGTCAACCATTCCCATCAACTCGCTGCGCGGAATCAAAAGCCAC
AAGAAGGTGCCACCACTCTCGGAACCGGGGCGTGTGGATGTCAGCGCGGATGTGGATTTCACTTCGCTGGCTGAA
GCGGCCATCGAAGGCAGCGACGGCGTCGAGGTTCACGGTCCTGTTGAACAGGGTGATTTCCTCGCAGCCATGGGT
ATTGAGGAGCGCATGCAGCAGTTGCTCCGTAAAGTGCAAGATGAAGAACACAAAAAGACACTAGAGACCGCCTGG
AAGCGATTGGTTGAGAAGAGCGGCGGATCAATGGGACAGATCTATAAGGTCATGGCCATTATACCTGAAAATGGA
GGGCAGAGACGGCCTGTTGGTTTTGGAGGCGGCATTCAGATGTAA
Transcript >Pro_DTO070G2_2|g7397.t1
ATGCCGTGGACGATTCTTTGGACGGCGGTAGCACCGGTCCTCTGTGTATTACTATCACTCGGCACACCGGCCTCG
GCTTTGAGTACCCACTCTGAACGCCTAGCTGCAGCTCTGAATGCCCCGGGTGCGTTCCAGTCGCAGCTCAAACCA
TGTCCAGCGCCGTGTGCTAGCCACGAGCCCCAGCACTGGACTGTCTATGCTTCCTTTGACCGGCTCTCCTTCTGC
CATGAGCCAATTCTTTTCGATATCGCCATTCACACTCCTGTGAATGACTTTTCTAAGACGCTAAAGTTTCGCGCC
TGCACCACAGGTGATGGCTGGGATGAGTCCAGGAATGCCGGTACAATTAGTGGAACGGTCTATGCGGGCCCCTCC
GTTCGGGAGTCCAAGGTGACGCTACAGGTTGCACAACAGAAATCTGCAGGAGCAGCTGAAGGCACCAGTGAGGAT
GTAATCACCGTGCTCACGCAGGTTCAGGCATACCTCCACGCAGGGATGGACTGCACCAAGAATATTATGCTGGGT
TACTACAAGGGGGTGGTTGTCGGCGTGTATGCCGGCCAGGCATTGGGTAAAGCTACAGCTTCATCTGTGATGGGC
CAGGTCCTCTCCAAGTTCAAGGGAGCGGCTCCCGCGACCACGCTTACACAGCTCTGCGGTGATCAGCGTGACGCA
GACCATGTCTTTGGTATTGCCACTTCAACCGTAGCGGACCTTTCTGCTGTGCAGGCCGCACTGGTATCATGGAGT
CAAGGGAAATGTGAGAGCGGACTCGGCGACGCGACCTCACTCCCGAATGTCAGTATCTGGGAGGTACCGCAACAT
CCAGTCGGAAGGAACAATACCACAACTTCAGATCCTACCGGTCAGGAACTTGATGCGCCCCTCCTCGCTCGCACA
GCCAAATACTGCAAAAAAAGGACGGTTGTCTCGGGTGACATCTGCCAGTCTCTAGCCAAGGCGTGCGGTATCACC
CTCGACCAGTTCTACAAGTACAACTCCAAGGAAATGTGTTCGAACCTGAAGATTGGCTCGAGTGTCTGCTGCACC
GACGGGTTCCTGAAGCCACAGCCTTACGATAACGGCACCTGCTATACATACACGACACAGACCGGTGATACATGC
TACGATATCGGCCTTGCCTGGAGTCTGACGGCCAAAGACCTTGGGAAATTTAACGATGGCACCACATGGGGCTGG
AACGGCTGCGACAACCTGGGTCACAGTCAGAACATATGTCTCAGCTCGGGACACCCCCCGATCCCGGCCGTTCTG
CCCAACGCTATCTGTGGGCCGCAAGTGCCCGGCACGATCTTGGACAGCCCTTTCACCAACGCCTCGGAATTTGCC
TTGCTGAACCCGTGCCCACTGAACTCGTGCTGCAACATCTGGGGCCAGTGCGGGATTGACTCAAGCTTTTGCACC
CTGTCCACCGGCCCCACGCGGAATCCGGGCACATCGAAGCCGGGAATATACGGCTGCATCTCGAACTGTGGTACC
GGCATTGTTAATAATCATGACGGTCCTTCGGGTGGCTACCAGCGCGTGGGCTACTATGAGGCGTTCAACTGGGAC
CGTAAATGTCTGCACATGCGTGCACAGTGGTCCAACACACTTGACTACACCCACATGCACTGGGCGTTTGGTTCT
ATTGGTGAGGACCTGTCTGTATACGTTAATGACTCGCACAGCCAGTGGTCCGGCTTTATGGATCTGAAAGACGTA
AAGAAGATAGTTTCCTTTGGGGGATGGGGTTTCTCGACGGATGTGTCAACCTACGACATCCTTCGCAAAGCCATG
GCCCCTGACAATCGCCACAAGTTCATCTCCAACCTCGTTGCCTTTGCCAATAGAACGGGTATAGACGGAATCGAC
ATTGACTGGGAGTATCCTGGGGCGCCTGATATCCCCGGAATCCCCCCTGGCCTCAATACAGATGCTCCCAACTAC
CTAGCGACGCTCAAGGCACTACGACAGGAGCTACCAGACAAATATTCCATTTCCATTGCCGCTCCAGCTTCATAC
TGGTATCTCAAAGCGTTCCCCATTAGCGATATTGCGAAAATTGTCGACTACATTGTTTACATGGCTTACGATCTA
CATGGCCAGTGGGATTATGGCAACATGTACACGCAGTCAGGATGCAAAAGTGGCAACTGTCTTCGCAGTCATGTT
AATCAGACTGAAGTGCTTCTGGCACTTGCTATGATTACCAAAGCAGGTGTGCATTCTAACAAGATAATGGTGGGT
GAGTCGAGTTACGGAAGATCCTTCAAGATGGCCAAACAGGGTTGCACAGGACCAGACTGCTTTTTCACTGGCACA
AATGAGACCTCCAATGCGAAGCCAGGTCGATGCACCGGTACCGGGGGCTATATCTCGAACGCGGAAATCAAGGAG
ATTATTTCGCATGGCGGTGAATCGGTCAAGACCTGGTACGACAAGGACACGGCCTCTGACTACGTAGTCTATGAG
AATGATCAATGGGTAGCTTACATGAGTTATAACACCAAGCAGGCGCGAAGGGACACATGGAAGAAACTTAATTTC
CTGGGGACGATTGACTGGGCGGTTGATCTCCAAGACTTCAATGTGGCTGACACCGTCGGTCCTACGGGAGACTAC
AACAAGTCGTCGTGCATCAATGTCTTCGACAACATGATCTGGAACTGGGTCAACCCGGTCATTGATGCCCCCGTC
GGGTGCACAAATCTTATCCAAGCGTCCCCATTGGCGACAACGGTGACCCGCACGGCATACACCACGATCACGCTG
GTGTCCGGGGGCACCGTCAGCACTACCATTGTGTCTACTGCCTTCCTCGTTTCTGAGGTCGATTACCAGCCGTTT
ACGATCGCCTCCTCGGATACGGAGAATGGGACCATCATCACATACAATCCCATCCCGCGTGTGACGCCGAGCCCC
ATGGGGATTCAGGTGCCGAAAGGGTGGGCGATCACTTCGCCCGACGGCGAGGTGGATGGTCCGTCCACCACCACA
GACTTGGTTGGTCTTCCCACCACCACCACCACCACCACCACCGATGCAGAAGGGTTCATAGTCTACATTACATGG
CAGCCCACGGTAAGCTACAGCCTGCCATCATTCGTCACACCCAAAATCCCTGCACCCACCATCCCTGACGACGAC
AACTCTCCCACCCCCATACCTGATCCAGGAGTAACCGACTGTATCGGTGATGCCTGCACTAAGGGGCCTGATTGC
ACCGACAGCGACTGTACACGCGGTGGAGACTGTACCGGCCCCGGCTGTACCCGCGGCGGCGACTGCACCGGTCCA
AAGTGCGTCCGGGGCGGAGTATGTACAGGCCACAACTGCGAGGAAGGGGGTCGCTGCTCAAGCGATCACTGCGTC
TCGGGTGGTGGGTGCTCGGGTGCCAAATGCAACAAGGGGGGCGGATGCTCAGGTGCCAAATGCAACAAGGGTGGC
GGCTGTGTGAAAACCTTACTGAATAATTGCAGCCCGGGACCCTGCGTCGGTCCGTCTTGCATTGATATGAGCTGT
CCGTGGTGCGACAACGGTATTACCATCACGGTTCAGCCTGGGGGGAATCCTGCGCCTACACCCAGGCCTACCTGT
CTGAACAACTGCCCGACATTACCTTCCTGCGCGGGCGGCGCCACATCGTGCAACGAGCCGTGCAACATCAATCGC
TGCCCCGCGAACAGCATGCCGACCGGAAAGGCCTGCACGAGCTTCACCACTGCCAGTGACTGCACGGTAATTATC
AGCAGCACGGCAGTCCATACCACCCCGACGAGGAGCTTCTCGACCACCACGCGAACTCGTTGCGAGACGGTGATC
GACTGCGACGTGCAAGATATGACAGTCACAACCACCATCACCACCAGCGAGGTCCCGGACGCAATTGCCTCCCCA
ACGGGGATATACGACTACGAGAACGACTCTCACTATAATCAGGCTGTGTTTGCAGCCGTTGCATCCGACTACGAT
GAGTGGGAAAGGACCGCAGACACCACCACGACCACGACCACGACTACGACAACCAGTAGCACACCTACGACTACC
ACTTCAACCTCAAGTCCTAACCCTAACTACCCGAATGAGTTCATGATATTGAAGTACGAGGTTCACACGGTATAC
TTTGATTTGAGTGAGAAGCACTCCTACTCTTGGTCCGGTGACTACTACGCCTACAATCAGGATTCGACAACCGAG
AACGTATGCACCAACTCCTACCGTGTAACTGGCCCTATCGACGCGGGCGCTAGTGATGATTATCCTGCATCACTG
GGTACTTTTGATCTCCCTGCACAGTACACGGGCTGCAAGTACTCCGGAAGTACCGACTCTGTAGGACCTCGCAAC
CCAGTACTTCTGAGATGCCCAGGGAGATGGAACTCCACATTTGAACAGAGAGAATGGTCCACGCCGCTGGCAAAA
ACATTGGCCAGTGTCATGAGGGTCACAGGTCCCGTACCAATCGCGGCGTTCATGCGTCAGGTATTGACTTCCCCA
GATGGCGGATATTATACAACTCGAGGGGAGGGCGGAGGTGTCTTCGGCAAAAATGGTGATTTCGTAACGTCGCCC
GAGATCTCGCAAGTCTTTGGAGAGTTGATCGGTATATGGACTATCGCGGAGTGGATGGCGCAGGGGCGGACAAAG
AGTGGTGTTCAGCTGATGGAGGTTGGTCCAGGAAAAGGAACTTTGATGGATGATATGCTACGGACTTTCCGAAAC
TTCAAGAGCTTTTCTTCGAGTGTTGAAGCTATTTACCTTGTGGAAGCTAGTGGAACTCTCCGAGAAGTGCAGAAG
CGGTTGCTGTGCGGCGAGAAGGCTGTGATGGAGGAGACAGATATCGGCCATCGGAGTGTGTGCAAGTACTTCGAT
GTACCCATCGTCTGGGTGGAGGATATTCGTCTTCTACCGCATGAGGAAGGCAAGACACCCTTCATCTTCGCACAT
GAATTCTTCGACGCGCTTCCAATTCACGCATTCGAATCTGTTCCACCATCACCAGAGAACCAGATTGCCAACGAG
CCAAGGAAGATCATGACTCCCACTGGCCCAGTAGAACTACATAATCCGCCCAAACACGCAAACACCCCGCAATGG
CGTGAGCTAATGGTGACATTAAATCCAAAAGCCGTGGAAGAGAACATAAAAGGAGAGCCCGAGTTTCAATTAACC
AAAGCCAAAGCTTCCACGCCGTCATCGCTAGTGATCCCGGAGATCTCCCAGCGTTACCGAGCACTGAAGTCGCAG
CCAGGCGCGACCATCGAGATCAGCCCCGAGAGCCGAATCTATGCTGCAGACTTTGCGCGCCGGATCGGTGGTGAC
TCTGCTTCTGCGCTTGCTGCTAAAAAGACCTCTCCCTCTAGCCCACCGCCGTCATCTCAGAAAAAGACTCCATCT
GGCGCAGCCCTGATCATGGACTACGGGACATTGTCAACCATTCCCATCAACTCGCTGCGCGGAATCAAAAGCCAC
AAGAAGGTGCCACCACTCTCGGAACCGGGGCGTGTGGATGTCAGCGCGGATGTGGATTTCACTTCGCTGGCTGAA
GCGGCCATCGAAGGCAGCGACGGCGTCGAGGTTCACGGTCCTGTTGAACAGGGTGATTTCCTCGCAGCCATGGGT
ATTGAGGAGCGCATGCAGCAGTTGCTCCGTAAAGTGCAAGATGAAGAACACAAAAAGACACTAGAGACCGCCTGG
AAGCGATTGGTTGAGAAGAGCGGCGGATCAATGGGACAGATCTATAAGGTCATGGCCATTATACCTGAAAATGGA
GGGCAGAGACGGCCTGTTGGTTTTGGAGGCGGCATTCAGATGTAA
Gene >Pro_DTO070G2_2|g7397.t1
ATGCCGTGGACGATTCTTTGGACGGCGGTAGCACCGGTCCTCTGTGTATTACTATCACTCGGCACACCGGCCTCG
GCTTTGAGTACCCACTCTGAACGCCTAGCTGCAGCTCTGAATGCCCCGGGTGCGTTCCAGTCGCAGCTCAAACCA
TGTCCAGCGCCGTGTGCTAGCCACGAGCCCCAGCACTGGACTGTCTATGCTTCCTTTGACCGGCTCTCCTTCTGC
CATGAGCCAATTCTTTTCGATATCGCCATTCACACTCCTGTGAATGACTTTTCTAAGACGCTAAAGTTTCGCGCC
TGCACCACAGGTGATGGCTGGGATGAGTCCAGGAATGCCGGTACAATTAGTGGAACGGTCTATGCGGGCCCCTCC
GTTCGGGAGTCCAAGGTGACGCTACAGGTTGCACAACAGAAATCTGCAGGAGCAGCTGAAGGCACCAGTGAGGAT
GTAATCACCGTGCTCACGCAGGTTCAGGCATACCTCCACGCAGGGATGGACTGCACCAAGAATATTATGCTGGGT
TACTACAAGGGGGTGGTTGTCGGCGTGTATGCCGGCCAGGCATTGGGTAAAGCTACAGCTTCATCTGTGATGGGC
CAGGTCCTCTCCAAGTTCAAGGGAGCGGCTCCCGCGACCACGCTTACACAGCTCTGCGGTGATCAGCGTGACGCA
GACCATGTCTTTGGTATTGCCACTTCAACCGTAGCGGACCTTTCTGCTGTGCAGGCCGCACTGGTATCATGGAGT
CAAGGGAAATGTGAGAGCGGACTCGGCGACGCGACCTCACTCCCGAATGTCAGTATCTGGGAGGTACCGCAACAT
CCAGTCGGAAGGAACAATACCACAACTTCAGATCCTACCGGTCAGGAACTTGATGCGCCCCTCCTCGCTCGCACA
GCCAAATACTGCAAAAAAAGGACGGTTGTCTCGGGTGACATCTGCCAGTCTCTAGCCAAGGCGTGCGGTATCACC
CTCGACCAGTTCTACAAGTACAACTCCAAGGAAATGTGTTCGAACCTGAAGATTGGCTCGAGTGTCTGCTGCACC
GACGGGTTCCTGAAGCCACAGCCTTACGATAACGGCACCTGCTATACATACACGACACAGACCGGTGATACATGC
TACGATATCGGCCTTGCCTGGAGTCTGACGGCCAAAGACCTTGGGAAATTTAACGATGGCACCACATGGGGCTGG
AACGGCTGCGACAACCTGGGTCACAGTCAGAACATATGTCTCAGCTCGGGACACCCCCCGATCCCGGCCGTTCTG
CCCAACGCTATCTGTGGGCCGCAAGTGCCCGGCACGATCTTGGACAGCCCTTTCACCAACGCCTCGGAATTTGCC
TTGCTGAACCCGTGCCCACTGAACTCGTGCTGCAACATCTGGGGCCAGTGCGGGATTGACTCAAGCTTTTGCACC
CTGTCCACCGGCCCCACGCGGAATCCGGGCACATCGAAGCCGGGAATATACGGCTGCATCTCGAACTGTGGTACC
GGCATTGTTAATAATCATGACGGTCCTTCGGGTGGCTACCAGCGCGTGGGCTACTATGAGGCGTTCAACTGGGAC
CGTAAATGTCTGCACATGCGTGCACAGTGGTCCAACACACTTGACTACACCCACATGCACTGGGCGTTTGGTTCT
ATTGGTGAGGACCTGTCTGTATACGTTAATGACTCGCACAGCCAGTGGTCCGGCTTTATGGATCTGAAAGACGTA
AAGAAGATAGTTTCCTTTGGGGGATGGGGTTTCTCGACGGATGTGTCAACCTACGACATCCTTCGCAAAGCCATG
GCCCCTGACAATCGCCACAAGTTCATCTCCAACCTCGTTGCCTTTGCCAATAGAACGGGTATAGACGGAATCGAC
ATTGACTGGGAGTATCCTGGGGTATTGATAACCTTTTATTTTGCCCTTTCGGTGGTACGCAAGCTGCTGACAGTA
GGTCTTGTCTCATCTAGGCGCCTGATATCCCCGGAATCCCCCCTGGCCTCAATACAGATGCTCCCAACTACCTAG
CGACGCTCAAGGCACTACGACAGGAGCTACCAGACAAATATTCCATTTCCATTGCCGCTCCAGCTTCATACTGGT
ATCTCAAAGCGTTCCCCATTAGCGATATTGCGAAAATTGTCGACTACATTGTTTACATGGCTTACGATCTACATG
GTCCCACCCCCCTCCCTTCCCCCTTCCCAATACCTTAGAGGTAGTCTACTAACATTTGACATTGATCTCCAGGCC
AGTGGGATTATGGCAACATGTACACGCAGTCAGGATGCAAAAGTGGCAACTGTCTTCGCAGTCATGTTAATCAGA
CTGAAGTGCTTCTGGCACTTGCTATGAGTAAGAATCTGGCCCCCTTGTTCATCGGCACATGTAATTCTAGTTGAA
GAAAGTTTTACTGATGTACCCATCGGTCAACAGTTACCAAAGCAGGTGTGCATTCTAACAAGATAATGGTGGGTG
AGTCGAGTTACGGAAGATCCTTCAAGATGGCCAAACAGGGTTGCACAGGACCAGACTGCTTTTTCACTGGCACAA
ATGAGACCTCCAATGCGAAGCCAGGTCGATGCACCGGTACCGGGGGCTATATCTCGAACGCGGAAATCAAGGAGA
TTATTTCGCATGGCGGTGAATCGGTCAAGACCTGGTACGACAAGGACACGGCCTCTGACTACGTAGTCTATGAGA
GTGAGTATCTTATTTTTCCGACCTCTGCCATCATCCGCACTCAGCATCATTCGTCAAGGAGACCTTATACTTATG
GATTGGTATACGCAGATGATCAATGGGTAGCTTACATGAGTTATAACACCAAGCAGGCGCGAAGGGACACATGGA
AGAAACTTAATTTCCTGGGGACGATTGACTGGGCGGTTGATCTCCAAGACTTCAATGTGGCTGACACCGTCGGTC
CTACGGGAGACTACAACAAGTCGTCGTGCATCAATGTCTTCGACAACATGATCTGGAACTGGGTCAACCCGGTCA
TTGATGCCCCCGTCGGGTGCACAAATCTTATCCAAGCGTCCCCATTGGCGACAACGGTGACCCGCACGGCATACA
CCACGATCACGCTGGTGTCCGGGGGCACCGTCAGCACTACCATTGTGTCTACTGCCTTCCTCGTTTCTGAGGTCG
ATTACCAGCCGTTTACGATCGCCTCCTCGGATACGGAGAATGGGACCATCATCACATACAATCCCATCCCGCGTG
TGACGCCGAGCCCCATGGGGATTCAGGTGCCGAAAGGGTGGGCGATCACTTCGCCCGACGGCGAGGTGGATGGTC
CGTCCACCACCACAGACTTGGTTGGTCTTCCCACCACCACCACCACCACCACCACCGATGCAGAAGGGTTCATAG
TCTACATTACATGGCAGCCCACGGTAAGCTACAGCCTGCCATCATTCGTCACACCCAAAATCCCTGCACCCACCA
TCCCTGACGACGACAACTCTCCCACCCCCATACCTGATCCAGGAGTAACCGACTGTATCGGTGATGCCTGCACTA
AGGGGCCTGATTGCACCGACAGCGACTGTACACGCGGTGGAGACTGTACCGGCCCCGGCTGTACCCGCGGCGGCG
ACTGCACCGGTCCAAAGTGCGTCCGGGGCGGAGTATGTACAGGCCACAACTGCGAGGAAGGGGGTCGCTGCTCAA
GCGATCACTGCGTCTCGGGTGGTGGGTGCTCGGGTGCCAAATGCAACAAGGGGGGCGGATGCTCAGGTGCCAAAT
GCAACAAGGGTGGCGGCTGTGTGAAAACCTTACTGAATAATTGCAGCCCGGGACCCTGCGTCGGTCCGTCTTGCA
TTGATATGAGCTGTCCGTGGTGCGACAACGGTATTACCATCACGGTTCAGCCTGGGGGGAATCCTGCGCCTACAC
CCAGGCCTACCTGTCTGAACAACTGCCCGACATTACCTTCCTGCGCGGGCGGCGCCACATCGTGCAACGAGCCGT
GCAACATCAATCGCTGCCCCGCGAACAGCATGCCGACCGGAAAGGCCTGCACGAGCTTCACCACTGCCAGTGACT
GCACGGTAATTATCAGCAGCACGGCAGTCCATACCACCCCGACGAGGAGCTTCTCGACCACCACGCGAACTCGTT
GCGAGACGGTGATCGACTGCGACGTGCAAGATATGACAGTCACAACCACCATCACCACCAGCGAGGTCCCGGACG
CAATTGCCTCCCCAACGGGGATATACGACTACGAGAACGACTCTCACTATAATCAGGCTGTGTTTGCAGCCGTTG
CATCCGACTACGATGAGTGGGAAAGGACCGCAGACACCACCACGACCACGACCACGACTACGACAACCAGTAGCA
CACCTACGACTACCACTTCAACCTCAAGTCCTAACCCTAACTACCCGAATGAGTTCATGATATTGAAGTACGAGG
TTCACACGGTATACTTTGATTTGAGTGAGAAGCACTCCTACTCTTGGTCCGGTGACTACTACGCCTACAATCAGG
ATTCGACAACCGAGAACGTATGCACCAACTCCTACCGTGTAACTGGCCCTATCGACGCGGGCGCTAGTGATGATT
ATCCTGCATCACTGGGTACTTTTGATCTCCCTGCACAGTACACGGGCTGCAAGTACTCCGGAAGTACCGACTCTG
TAGGGTCGGTTACATGCGGCTCAAAAACCTTCTCGTGCAGCAAATTCCAAGATTATGACGGGAAAACCGCCACGT
TTGATTGCGGTAAGACTACAGCCGATGGTGGTAGTACATATATATACCATTACTACTATGAGGCGATCCAGTGTG
CCATCACTTACTAAATGATCCCCCCGGCGTTGTGATATCAAAGAGGATAGGGGAATTCTACAATAAAAGAACAAT
TATAACTATTTGCGTTATTATATGTGTTTTTCAAGGCTCAAAGCAGATCTTCCTTTAACATCTCCGAGTTTCAGA
AGACAAAGTTTGAAATTAGCTTACAGTGTCAAAACTAGAGCTAGAAAGGGCCAGCGGCTATATAAGCCTAAAACT
CATGCTTTTCCCTTTGCATTTTGGACGATCGGTCTGCGCTCTGAATAAAGCCGCACTTCGTACCCGCATCTTAAG
AGCCTCCCTTCACGTGGATTTCCCTCTTGCTTTCTTTTAAAGCTCAGCTACAGGCGACGCCCTAGAGGATTTCTA
CGGATTACCTGGATGGGACAAAATTTCGGGCCCACTTATCTTGGTGTACAATATATAATACTAATTAGCTAGTTT
GAGGATAGATAGACTCGGCCTCTTGATTGAATCTGCCTATGTATACTATTGCTAGTGGCTACAGCTAGTACTGTG
CTTATTGATATAGTCTTTAGGGCTTGGATTTCCGAGCCATACCATCTTAGGACTAGCGGCCGATAACCGTCCGAT
AAAGATATGATCACGTGCAGTGGAGCTTCCGCGGAGAGATTGAGAGAAACATCTCGACTTGGCGCAAGGCAATAG
AAGGAGTGTTTGGCCCGGTCATTTTGTTTACCTGCCGCAAACAGTTCCATTGTTGTATATCTGATGATACGAATA
ATTACTGCCCCCCAAACCCGAGCCAAGAATGAACCAGACCACGAGGCGCGTAGCGTCGTACGTCCTCCGTAGACC
TCGCAACCCAGTACTTCTGAGATGCCCAGGGAGATGGAACTCCACATTTGAACAGAGAGAATGGTCCACGCCGCT
GGCAAAAACATTGGCCAGTGTCATGAGGGTAAATATGCACTTAGCTTTAACCTCTCTGCTCTTTTGCTGATCATT
GACACCGCAAATTAGGTCACAGGTCCCGTACCAATCGCGGCGTTCATGCGTCAGGTATTGACTTCCCCAGATGGC
GGATATTATACAACTCGAGGGGAGGGCGGAGGTGTCTTCGGCAAAAATGGTGATTTCGTAACGTCGCCCGAGATC
TCGCAAGTCTTTGGAGAGTTGATCGGTATATGGACTATCGCGGAGTGGATGGCGCAGGGGCGGACAAAGAGTGGT
GTTCAGCTGATGGAGGTTGGTCCAGGAAAAGGAACTTTGATGGATGATATGCTACGGGTGGGTAGTTGCACTTAT
ACCTGTCTTCCTTTTATAAGAAAGAGCTCATTGGACTGACCACGATTTCTATAACCAACAGACTTTCCGAAACTT
CAAGAGCTTTTCTTCGAGTGTTGAAGCTATTTACCTTGTGGAAGCTAGTGGAACTCTCCGAGAAGTGCAGAAGCG
GTTGCTGTGCGGCGAGAAGGCTGTGATGGAGGAGACAGATATCGGCCATCGGAGTGTGTGCAAGTACTTCGATGT
ACCCATCGTCTGGGTGGAGGATATTCGTCTTCTACCGCATGGTGAGTGATGCTTTCAATCCGGTTTTACCCTTTT
GTCTGATGCTGACCAATGACATCGGCGACACAGAGGAAGGCAAGACACCCTTCATCTTCGCACATGAATTCTTCG
ACGCGCTTCCAATTCACGCATTCGAATCTGTTCCACCATCACCAGAGAACCAGATTGCCAACGAGCCAAGGAAGA
TCATGACTCCCACTGGCCCAGTAGAACTACATAATCCGCCCAAACACGCAAACACCCCGCAATGGCGTGAGCTAA
TGGTGACATTAAATCCAAAAGCCGTGGAAGAGAACATAAAAGGAGAGCCCGAGTTTCAATTAACCAAAGCCAAAG
CTTCCACGCCGTCATCGCTAGTGATCCCGGAGATCTCCCAGCGTTACCGAGCACTGAAGTCGCAGCCAGGCGCGA
CCATCGAGATCAGCCCCGAGAGCCGAATCTATGCTGCAGACTTTGCGCGCCGGATCGGTGGTGACTCTGCTTCTG
CGCTTGCTGCTAAAAAGACCTCTCCCTCTAGCCCACCGCCGTCATCTCAGAAAAAGACTCCATCTGGCGCAGCCC
TGATCATGGACTACGGGACATTGTCAACCATTCCCATCAACTCGCTGCGCGGAATCAAAAGCCACAAGAAGGTGC
CACCACTCTCGGAACCGGGGCGTGTGGATGTCAGCGCGGATGTGGATTTCACTTCGCTGGCTGAAGCGGCCATCG
AAGGCAGCGACGGCGTCGAGGTTCACGGTCCTGTTGAACAGGGTGATTTCCTCGCAGCCATGGGTATTGAGGAGC
GCATGCAGCAGTTGCTCCGTAAAGTGCAAGATGAAGAACACAAAAAGACACTAGAGACCGCCTGGAAGCGATTGG
TTGAGAAGAGCGGCGGATCAATGGGACAGATCTATAAGGTCATGGCCATTATACCTGAAAATGGAGGGCAGAGAC
GGCCTGTTGGTTTTGGAGGCGGCATTCAGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail