Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7359.t1
Gene name
Locationscaffold_13:38663..39894
Strand+
Gene length (bp)1231
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28 9.8E-126 51 369

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004650 polygalacturonase activity Yes
GO:0071704 organic substance metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7359.t1
MRTSFVSMLALGAAVVSAAPAPTSVSELVERSSSTCTFTSAASAIASKKACSTIVLDNIEVPAGVTLDLTKLESG
TKVIFKGETTFGYKEWTGPLISISGSKIEVSGQSGHVINGGGASWWDSEGTNGGKTKPKFFYAHSLDDSSITGLN
VKNTPVQAFSVQSDNLVLDQITIDNSDGDTEGGHNTDAFDVGSSTYITISNANVKNQDDCLAINSGENIVFTGGY
CSGGHGLSIGSVGLRSDNTVKNVTISDSTVTNSANGVRVKTVYKATGAVSGVTFSNIKLSEISSYGIVIEQDYEN
GSPTGTPTTGVPITDLTVEKVTGTVKSSATDVYILCGSGSCSDWTWSGNSVTGGKTSSKCENVPSGASC*
Coding >Pro_DTO070G2_2|g7359.t1
ATGCGTACATCTTTCGTTTCCATGCTGGCCCTCGGCGCCGCCGTTGTGTCTGCTGCCCCAGCTCCTACTAGTGTT
TCCGAACTGGTTGAGCGCTCGTCCTCGACTTGCACCTTTACCTCAGCCGCCAGCGCCATTGCTAGCAAGAAGGCT
TGTTCCACCATTGTGCTGGATAACATCGAAGTCCCTGCTGGCGTGACTCTCGATCTTACCAAGCTGGAGAGTGGT
ACCAAGGTCATCTTCAAGGGCGAAACTACCTTCGGATATAAAGAGTGGACGGGTCCCCTTATCAGCATCTCCGGC
TCAAAGATTGAAGTCAGTGGACAGTCAGGCCATGTCATCAACGGCGGCGGAGCGAGCTGGTGGGACAGCGAGGGA
ACCAACGGCGGAAAGACCAAGCCCAAGTTCTTCTACGCCCACTCCCTGGACGACTCGTCCATCACCGGCCTGAAC
GTCAAGAACACCCCCGTCCAGGCTTTCAGTGTGCAGTCCGATAACCTGGTCCTCGACCAGATCACCATCGACAAC
TCGGACGGTGATACTGAGGGCGGCCACAACACCGATGCCTTCGATGTTGGCTCGAGCACCTATATCACCATCAGC
AACGCCAATGTCAAGAACCAGGATGACTGCTTGGCTATCAACTCTGGCGAGAACATCGTATTCACCGGCGGCTAC
TGCTCCGGCGGTCACGGTCTCTCCATTGGCTCCGTTGGCTTGCGCTCCGACAACACTGTGAAGAACGTGACCATC
TCCGACTCTACCGTGACCAACTCCGCCAACGGTGTGCGCGTCAAGACCGTCTACAAGGCCACTGGTGCAGTCTCT
GGCGTGACCTTCTCCAACATCAAGCTGTCCGAGATCTCTAGCTATGGTATTGTCATCGAGCAGGATTACGAGAAC
GGCAGCCCTACCGGTACCCCCACTACTGGTGTCCCCATTACCGACCTGACTGTCGAGAAGGTTACCGGCACTGTC
AAGAGCAGCGCTACTGACGTCTACATTCTTTGCGGTAGCGGTAGCTGCTCTGACTGGACCTGGTCTGGAAATTCC
GTCACTGGTGGTAAGACTAGCAGTAAGTGCGAGAATGTGCCTTCTGGTGCTTCTTGCTAG
Transcript >Pro_DTO070G2_2|g7359.t1
ATGCGTACATCTTTCGTTTCCATGCTGGCCCTCGGCGCCGCCGTTGTGTCTGCTGCCCCAGCTCCTACTAGTGTT
TCCGAACTGGTTGAGCGCTCGTCCTCGACTTGCACCTTTACCTCAGCCGCCAGCGCCATTGCTAGCAAGAAGGCT
TGTTCCACCATTGTGCTGGATAACATCGAAGTCCCTGCTGGCGTGACTCTCGATCTTACCAAGCTGGAGAGTGGT
ACCAAGGTCATCTTCAAGGGCGAAACTACCTTCGGATATAAAGAGTGGACGGGTCCCCTTATCAGCATCTCCGGC
TCAAAGATTGAAGTCAGTGGACAGTCAGGCCATGTCATCAACGGCGGCGGAGCGAGCTGGTGGGACAGCGAGGGA
ACCAACGGCGGAAAGACCAAGCCCAAGTTCTTCTACGCCCACTCCCTGGACGACTCGTCCATCACCGGCCTGAAC
GTCAAGAACACCCCCGTCCAGGCTTTCAGTGTGCAGTCCGATAACCTGGTCCTCGACCAGATCACCATCGACAAC
TCGGACGGTGATACTGAGGGCGGCCACAACACCGATGCCTTCGATGTTGGCTCGAGCACCTATATCACCATCAGC
AACGCCAATGTCAAGAACCAGGATGACTGCTTGGCTATCAACTCTGGCGAGAACATCGTATTCACCGGCGGCTAC
TGCTCCGGCGGTCACGGTCTCTCCATTGGCTCCGTTGGCTTGCGCTCCGACAACACTGTGAAGAACGTGACCATC
TCCGACTCTACCGTGACCAACTCCGCCAACGGTGTGCGCGTCAAGACCGTCTACAAGGCCACTGGTGCAGTCTCT
GGCGTGACCTTCTCCAACATCAAGCTGTCCGAGATCTCTAGCTATGGTATTGTCATCGAGCAGGATTACGAGAAC
GGCAGCCCTACCGGTACCCCCACTACTGGTGTCCCCATTACCGACCTGACTGTCGAGAAGGTTACCGGCACTGTC
AAGAGCAGCGCTACTGACGTCTACATTCTTTGCGGTAGCGGTAGCTGCTCTGACTGGACCTGGTCTGGAAATTCC
GTCACTGGTGGTAAGACTAGCAGTAAGTGCGAGAATGTGCCTTCTGGTGCTTCTTGCTAG
Gene >Pro_DTO070G2_2|g7359.t1
ATGCGTACATCTTTCGTTTCCATGCTGGCCCTCGGCGCCGCCGTTGTGTCTGCTGCCCCAGCTCCTACTAGTGTT
TCCGAACTGGTTGAGCGCTCGTCCTCGACTTGCACCTTTACCTCAGCCGCCAGCGCCATTGCTAGCAAGAAGGCT
TGTTCCACCATTGTGCTGGATAACATCGAAGTCCCTGCTGGCGTGACTCTCGATCTTACCAAGCTGGAGAGTGGT
ACCAAGGTAGATATTTCTGTTATTCAAGGGTCGATAACCAAAGATCTAATAGCTGCTGTATAGGTCATCTTCAAG
GGCGAAACTACCTTCGGATATAAAGAGTGGACGGGTCCCCTTATCAGCATCTCCGGCTCAAAGATTGAAGTCAGT
GGACAGTCAGGCCATGTCATCAACGGCGGCGGAGCGAGCTGGTGGGACAGCGAGGGAACCAACGGCGGAAAGACC
AAGCCCAAGTTCTTCTACGCCCACTCCCTGGACGACTCGTCCATCACCGGCCTGAACGTCAAGAACACCCCCGTC
CAGGCTTTCAGTGTGCAGTCCGATAACCTGGTCCTCGACCAGATCACCATCGACAACTCGGACGGTGATACTGAG
GGCGGCCACAACACCGATGCCTTCGATGTTGGCTCGAGCACCTATATCACCATCAGCAACGCCAATGTCAAGAAC
CAGGATGACTGCTTGGCTATCAACTCTGGCGAGGTAAGCAGTCAAAGGATACTTCTACCATAAAAAAACAAATGA
AACTAACCTGGTTGTCCGCCAGAACATCGTATTCACCGGCGGCTACTGCTCCGGCGGTCACGGTCTCTCCATTGG
CTCCGTTGGCTTGCGCTCCGACAACACTGTGAAGAACGTGACCATCTCCGACTCTACCGTGACCAACTCCGCCAA
CGGTGTGCGCGTCAAGACCGTCTACAAGGCCACTGGTGCAGTCTCTGGCGTGACCTTCTCCAACATCAAGCTGTC
CGAGATCTCTAGCTATGGTATTGTCATCGAGCAGGATTACGAGAACGGCAGCCCTACCGGTACCCCCACTACTGG
TGTCCCCATTACCGACCTGACTGTCGAGAAGGTTACCGGCACTGTCAAGAGCAGCGCTACTGACGTCTACATTCT
TTGCGGTAGCGGTAGCTGCTCTGACTGGACCTGGTCTGGAAATTCCGTCACTGGTGGTAAGACTAGCAGTAAGTG
CGAGAATGTGCCTTCTGGTGCTTCTTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail