Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7325.t1
Gene name
Locationscaffold_12:531821..532945
Strand+
Gene length (bp)1124
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05390 Kre9_KNH1_C Yeast cell wall synthesis protein KRE9/KNH1 C-terminal 5.4E-07 217 294

GO

GO Term Description Terminal node
GO:0042546 cell wall biogenesis Yes
GO:0006078 (1->6)-beta-D-glucan biosynthetic process Yes
GO:0044262 cellular carbohydrate metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0051273 beta-glucan metabolic process No
GO:0009058 biosynthetic process No
GO:0071554 cell wall organization or biogenesis No
GO:0009250 glucan biosynthetic process No
GO:0009987 cellular process No
GO:0006073 cellular glucan metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0008152 metabolic process No
GO:0044085 cellular component biogenesis No
GO:0000271 polysaccharide biosynthetic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006077 (1->6)-beta-D-glucan metabolic process No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0071840 cellular component organization or biogenesis No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044042 glucan metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0005976 polysaccharide metabolic process No
GO:0051274 beta-glucan biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7325.t1
MRVQLLQVALLFTAVYGQISSQITTYDLSFDGAAVVSLLWGLDGEPTSTYNFYLCAGDETTGSYDTLSQVINNGA
YAPGDMVSFRVDQSVGGNEPNAYFLKIVLSGPHNYWSGFTSHFTLTNMKGTFSTKVTNAIKTMQPIPAVVISWPT
VKDDDHLIEAADLTSICNSSSLAKSSSTEATLQFPTSTAKGEAEHNELRKRQVAAVGGVGDVSVVDQHTVPYGEQ
TGSIKYAPMPKSAGTTVATRSATPQYPPFPFSIATSYLGAPTIQYTDTAFATWTANTIENTAAPAPAPTLDKRMQ
KWLDRWND*
Coding >Pro_DTO070G2_2|g7325.t1
ATGAGAGTCCAATTACTTCAGGTCGCCCTGTTATTCACGGCCGTCTATGGCCAGATCAGTTCTCAGATCACAACA
TATGATCTGAGTTTCGACGGTGCAGCTGTCGTGAGTCTGCTTTGGGGCTTAGATGGCGAACCAACTTCAACTTAT
AATTTTTATCTCTGTGCCGGTGATGAGACAACAGGTTCATATGACACTCTATCGCAAGTTATCAACAATGGCGCC
TATGCTCCTGGTGACATGGTGTCATTTCGTGTCGATCAAAGTGTCGGTGGGAATGAACCCAATGCATACTTTCTC
AAGATAGTCCTATCAGGCCCTCATAACTACTGGTCCGGGTTCACCTCTCATTTCACTTTGACCAACATGAAAGGT
ACATTCTCGACCAAAGTAACAAATGCGATCAAGACGATGCAGCCGATTCCCGCCGTCGTTATTTCCTGGCCTACA
GTCAAAGACGATGACCACCTCATCGAGGCCGCAGATCTCACTTCAATTTGCAACTCCTCTAGTCTCGCCAAGAGT
TCCTCAACCGAAGCCACCTTGCAGTTCCCAACCTCAACCGCCAAGGGCGAAGCCGAGCACAATGAATTGCGCAAA
CGACAAGTGGCTGCTGTCGGCGGCGTTGGCGATGTTTCTGTAGTTGACCAGCATACCGTCCCATACGGTGAACAG
ACTGGCTCGATCAAATATGCCCCGATGCCTAAGAGCGCTGGGACTACTGTCGCCACCAGATCAGCCACTCCTCAA
TACCCGCCTTTCCCGTTCTCTATTGCAACCAGCTACTTAGGTGCGCCAACCATCCAGTACACGGATACAGCTTTT
GCGACATGGACGGCGAACACCATCGAGAACACGGCTGCGCCCGCTCCTGCGCCCACATTGGACAAGAGAATGCAG
AAGTGGTTGGACCGTTGGAATGATTGA
Transcript >Pro_DTO070G2_2|g7325.t1
ATGAGAGTCCAATTACTTCAGGTCGCCCTGTTATTCACGGCCGTCTATGGCCAGATCAGTTCTCAGATCACAACA
TATGATCTGAGTTTCGACGGTGCAGCTGTCGTGAGTCTGCTTTGGGGCTTAGATGGCGAACCAACTTCAACTTAT
AATTTTTATCTCTGTGCCGGTGATGAGACAACAGGTTCATATGACACTCTATCGCAAGTTATCAACAATGGCGCC
TATGCTCCTGGTGACATGGTGTCATTTCGTGTCGATCAAAGTGTCGGTGGGAATGAACCCAATGCATACTTTCTC
AAGATAGTCCTATCAGGCCCTCATAACTACTGGTCCGGGTTCACCTCTCATTTCACTTTGACCAACATGAAAGGT
ACATTCTCGACCAAAGTAACAAATGCGATCAAGACGATGCAGCCGATTCCCGCCGTCGTTATTTCCTGGCCTACA
GTCAAAGACGATGACCACCTCATCGAGGCCGCAGATCTCACTTCAATTTGCAACTCCTCTAGTCTCGCCAAGAGT
TCCTCAACCGAAGCCACCTTGCAGTTCCCAACCTCAACCGCCAAGGGCGAAGCCGAGCACAATGAATTGCGCAAA
CGACAAGTGGCTGCTGTCGGCGGCGTTGGCGATGTTTCTGTAGTTGACCAGCATACCGTCCCATACGGTGAACAG
ACTGGCTCGATCAAATATGCCCCGATGCCTAAGAGCGCTGGGACTACTGTCGCCACCAGATCAGCCACTCCTCAA
TACCCGCCTTTCCCGTTCTCTATTGCAACCAGCTACTTAGGTGCGCCAACCATCCAGTACACGGATACAGCTTTT
GCGACATGGACGGCGAACACCATCGAGAACACGGCTGCGCCCGCTCCTGCGCCCACATTGGACAAGAGAATGCAG
AAGTGGTTGGACCGTTGGAATGATTGA
Gene >Pro_DTO070G2_2|g7325.t1
ATGAGAGTCCAATTACTTCAGGTCGCCCTGTTATTCACGGCCGTCTATGGCCAGATCAGTTCTCAGATCACAACA
TATGATCTGAGTTTCGACGGTGCAGCTGTCGTGAGTCTGCTTTGGGGCTTAGATGGCGAACCAACTTCAACTTAT
AATTTTTATCTCTGTGCCGGTGATGAGACAACAGGTTCATATGTATGTTTCTCTCTATACGGAACTGCAAAACAT
AGAGCTAACCACACATCTAGGACACTCTATCGCAAGTTATCAACAATGGCGCCTATGCTCCTGGTGACATGGTGT
CATTTCGTGTCGATCAAAGTGTCGGTGGGAATGAACCCAATGCATAGTAAGACAATTCATTTGCCTCTGACATCG
GCGGCTTCATCAATTCGCTTTGTGACTGACCAATGTCCCTGGGGCCCAATCAGCTTTCTCAAGATAGTCCTATCA
GGCCCTCATAACTACTGGTCCGGGTTCACCTCTCATTTCACTTTGACCAACATGAAAGGTACATTCTCGACCAAA
GTAACAAATGCGATCAAGACGATGCAGCCGATTCCCGCCGTCGTTATTTCCTGGCCTACAGTCAAAGACGATGAC
CACCTCATCGAGGCCGCAGATCTCACTTCAATTTGCAACTCCTCTAGTCTCGCCAAGAGTTCCTCAACCGAAGCC
ACCTTGCAGTTCCCAACCTCAACCGCCAAGGGCGAAGCCGAGCACAATGAATTGCGCAAACGACAAGTGGCTGCT
GTCGGCGGCGTTGGCGATGTTTCTGTAGTTGACCAGCATACCGTCCCATACGGTGAACAGACTGGCTCGATCAAA
TATGCCCCGATGCCTAAGAGCGCTGGGACTACTGTCGCCACCAGATCAGCCACTCCTCAATACCCGCCTTTCCCG
TTCTCTATTGCAACCAGCTACTTAGGTGCGCCAACCATCCAGTACACGGATACAGCTTTTGCGACATGGACGGCG
AACACCATCGAGAACACGGTGAGTTTGATTCTTGCTTGTTGTCGATTGGGTTTGAAAGCTAATCCTCCGTTTGTG
TTCAGGCTGCGCCCGCTCCTGCGCCCACATTGGACAAGAGAATGCAGAAGTGGTTGGACCGTTGGAATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail