Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g7106.t1
Gene name
Locationscaffold_11:556769..562469
Strand+
Gene length (bp)5700
Transcript length (bp)4587
Coding sequence length (bp)4587
Protein length (aa) 1529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 6.0E-55 150 354
PF10256 Erf4 Golgin subfamily A member 7/ERF4 family 5.0E-39 1381 1497

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 142 164 22
3 171 193 22
4 203 222 19
5 229 246 17
6 256 274 18
7 281 303 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g7106.t1
MRWSFIFVLIVSLFLLGTLAAPASPAGRRNVAFANLEVRQEKETDSTKTDAASETTTATQTDTSKTTTEASTSVE
TTTTGATTSSTDSTTTTHATTHATTTTSAASATSTVPSLDGATESSQQEAADSSRPTYSGGLPIKPVITPAWGVG
GVILIALGAVLAFIGVRQQWVQIFLSTGFLSALGVTVLIIYVMSPPVSNAVQGGYLVAVFFTGVVFGALSLVFRE
ICEGLGCLLGGFCLSMWFLALKSGGLVTESGSRVGMIIAFTVGFYCLSFSHYTRSYGLIGCTSFAGATALVLGID
CFSRAGLKEFWLYNWNLNQNVFPLNTDTYPVTRGIRVELAVTIIIAVLGVISQIRLWNLIKERRTKEEESRLEHT
RKIEEEDLEIGRRLEEKNIQERAEWELIYGTGKAADGKTASVSETAVDDSRRGSEAFESSDNDREGEIELKEISS
PDASGSGSDGEKNRQGENGTRELEAVPEEDSSQQGQSQDAEEKGVEQEGRSEEKVPRPTTPVMTHILGEGNDESS
EIGAEIGSEVGTPRSKRFSGREMLNRMSWRLSNGVMTTSQSQENLVAHDDASSSVLGVVDDLHEMSVGCPSVLSD
ADVHEQTREIRAELSPEKDSAGVDIKSKSGSQAIQDAGLHVDTAISQDAEKVTTEEVDTSDTVQQVSPVESTVIA
NSPLENSGISEVSEKPQSPETPATDVQADIPDASKKIGEVKPKPTLEQSPMNDAEVENVEANEDQPPTAKTIKAE
SIPESKAASLPEPKVEPKIKVIKKLDASSIKHIPEQTSRVIHSYRTNEWAKHLADADTPEMEPLEFEPEPEAEAS
EEVRETAAFVDVGGLLQTPLTAQPPPIVNRPEFDDMDNQQPYISSTPSPDIPRSKTRTGTQGLSKANPSLTRNDS
TASVNMLPSAFNPFITQEPGLTSMRCASTPLLTVTTPNEPKEAEPSSRWNGPPPLLAIRENMVRNRMSSTSNRFD
PWAARNLSRQSLPDMAPLVSPVAPVSPPLSIPEEKEIEPEPNEDDIPLSKRRALLQRQTMRSSSALSIENLQAAQ
SPMYPPAEPAGELKRSASRMAAWRQSVREEITQKRNPLAMQSPPLSPAGPPDQRRTWSSVQQMREASSAQLGNAI
ADGMQRGNMTDLHRQAMRQAYCYPRGQQFINRPPTNRASVESTPSFVRAQRRQCVPISGPPSLLRPPAVRLANPV
NHVPRITPITVRPQQSDESLPLSFDHSRDVHPLLSVPERRRSRLSPSPNSLLVERSQGETESGRTSIALPRRHRR
SEEFTEMTAAFAGSAARETENLRPPEAVHLTQSGTRQNDRFRYTQSQTSFHSQSQSQSQIASVPSHTGYPHADVA
EELAWGPAHPCFPHINPHVPLGSREYLTTRVIRIRRDWMIKGDLAPTFSNLYPEILDPLLSEQEFRRVISTVNDG
VIKAFDPFSFRNWFDSTMGLLTGWVWDDINAPATKSQLQRVEAWLENWNREVGAKDGVHIWSLRRTAYMSLDIQI
PDPKVGIVPSEAPSAANTRPSTGIGAGS*
Coding >Pro_DTO070G2_2|g7106.t1
ATGCGGTGGTCTTTTATATTCGTCTTAATAGTGTCCCTGTTTCTACTAGGGACATTGGCAGCGCCAGCTTCGCCC
GCGGGACGACGCAATGTTGCATTCGCCAACTTGGAGGTCAGACAGGAAAAGGAAACGGATTCTACAAAGACAGAT
GCTGCCAGTGAGACTACGACGGCAACACAAACAGATACATCAAAAACAACAACCGAGGCATCAACATCTGTCGAA
ACTACAACGACAGGCGCTACTACCTCGAGTACTGACTCGACTACTACAACGCATGCGACAACGCATGCCACAACA
ACGACTTCTGCCGCTTCTGCTACCTCCACTGTACCTTCGCTCGACGGAGCAACTGAATCTTCTCAACAGGAAGCA
GCAGACTCCAGTAGGCCGACCTACTCCGGTGGTCTGCCAATCAAACCAGTGATCACGCCGGCATGGGGTGTTGGG
GGAGTTATACTTATTGCCCTCGGGGCTGTTCTGGCTTTCATTGGTGTCCGGCAACAATGGGTCCAAATCTTCCTC
TCAACCGGATTTCTTAGCGCATTGGGAGTTACCGTCCTTATTATCTATGTGATGAGCCCACCGGTCAGCAATGCT
GTACAGGGCGGTTACCTCGTCGCTGTCTTCTTCACCGGCGTTGTGTTCGGTGCTTTATCGCTCGTCTTCAGAGAG
ATATGCGAGGGACTGGGCTGTCTTCTGGGCGGTTTCTGCCTGAGCATGTGGTTCCTTGCCTTGAAATCCGGCGGC
CTTGTAACCGAAAGTGGCTCCAGGGTCGGTATGATCATTGCCTTTACTGTAGGTTTCTACTGCCTGTCATTCAGC
CATTATACCCGATCATACGGGTTGATCGGTTGCACATCATTCGCCGGTGCAACTGCCTTAGTCCTTGGAATCGAT
TGCTTTAGCAGAGCTGGGTTGAAGGAGTTCTGGTTATACAACTGGAACTTGAACCAAAATGTCTTCCCTCTTAAC
ACGGACACTTACCCCGTGACACGTGGTATTCGTGTTGAGCTCGCCGTGACTATCATTATCGCTGTTCTAGGAGTA
ATCTCCCAGATCAGACTTTGGAATCTCATCAAGGAGCGCAGAACCAAGGAAGAAGAATCCCGCCTGGAACACACT
CGAAAGATCGAAGAAGAAGATCTCGAAATCGGTCGCCGACTCGAGGAGAAGAATATCCAAGAACGTGCTGAATGG
GAACTCATTTACGGAACCGGCAAAGCCGCCGATGGCAAAACCGCCTCGGTTTCGGAGACTGCTGTTGATGACTCG
CGACGGGGCTCGGAGGCGTTTGAGTCCTCTGACAACGACAGGGAGGGTGAGATCGAGCTCAAGGAAATCTCGAGC
CCCGATGCTTCCGGTAGTGGTTCTGATGGAGAGAAGAACCGCCAGGGTGAAAACGGTACTCGCGAACTTGAGGCT
GTGCCTGAGGAGGATTCATCCCAACAGGGTCAATCACAAGATGCAGAGGAAAAGGGCGTCGAGCAAGAGGGTCGA
TCTGAAGAAAAGGTGCCGAGACCTACCACACCTGTTATGACTCATATCCTTGGTGAGGGCAATGATGAGTCCTCT
GAGATCGGTGCTGAGATCGGCTCAGAGGTCGGCACGCCGCGCTCGAAACGGTTCTCCGGCAGAGAAATGTTGAAC
CGGATGTCTTGGCGGCTCAGCAATGGTGTTATGACGACTTCACAGTCGCAGGAGAATCTGGTGGCTCATGATGAT
GCCAGCTCTTCTGTCCTGGGGGTTGTGGATGATCTCCATGAGATGAGCGTCGGCTGTCCGAGTGTTCTATCGGAT
GCGGATGTTCACGAGCAAACGCGCGAAATTAGAGCCGAGTTATCTCCAGAGAAGGACTCGGCAGGTGTGGACATC
AAGTCAAAATCCGGCTCACAAGCCATCCAAGATGCTGGACTCCATGTCGATACAGCCATATCCCAGGATGCCGAG
AAAGTGACCACCGAAGAAGTCGATACTAGCGACACTGTTCAGCAGGTGTCTCCCGTCGAGAGCACTGTTATTGCC
AACAGTCCCCTTGAGAATTCTGGAATTTCCGAAGTGTCGGAGAAGCCACAATCGCCAGAAACCCCCGCAACAGAT
GTTCAAGCAGACATTCCAGATGCCTCAAAGAAGATCGGGGAAGTCAAGCCCAAACCTACATTGGAGCAGTCACCT
ATGAATGATGCAGAAGTGGAAAATGTGGAGGCCAATGAAGATCAACCTCCTACTGCTAAAACCATCAAGGCCGAG
TCTATTCCTGAGTCGAAGGCTGCATCTTTGCCCGAGCCCAAGGTTGAGCCAAAGATCAAAGTAATCAAAAAACTA
GATGCGTCAAGCATCAAGCACATCCCCGAGCAAACATCACGAGTGATCCATTCGTACCGGACGAACGAATGGGCC
AAGCATCTCGCAGATGCGGACACCCCTGAGATGGAGCCGCTTGAGTTCGAACCTGAACCCGAGGCAGAAGCCTCA
GAGGAAGTTCGCGAGACTGCAGCATTTGTCGATGTAGGCGGTCTTCTCCAGACGCCTCTTACTGCACAACCACCA
CCAATCGTGAACAGACCTGAATTTGATGATATGGACAATCAACAACCATACATCTCATCGACACCCTCACCAGAT
ATTCCCCGATCAAAGACACGGACAGGCACGCAAGGTCTCAGCAAAGCGAATCCAAGTCTAACCCGGAACGATTCG
ACAGCTTCGGTCAATATGCTACCATCAGCTTTTAATCCTTTCATAACCCAAGAACCGGGATTGACGTCGATGCGC
TGCGCATCGACTCCCCTGTTGACAGTCACTACTCCCAACGAGCCCAAAGAAGCAGAGCCATCATCACGCTGGAAC
GGGCCACCTCCCCTTCTCGCAATCCGCGAGAACATGGTCCGAAACCGCATGTCCTCAACATCCAACCGCTTCGAT
CCCTGGGCCGCACGCAACTTATCCCGACAGTCTCTACCTGATATGGCACCCCTCGTCTCCCCAGTAGCACCAGTA
TCACCGCCGCTCTCCATCCCGGAAGAAAAGGAGATAGAACCCGAACCCAACGAGGATGACATCCCACTTTCCAAA
CGGCGCGCCCTGCTACAGCGCCAGACAATGCGGTCTTCATCTGCATTAAGCATTGAGAATCTCCAGGCTGCCCAG
TCCCCTATGTATCCCCCGGCAGAACCCGCCGGCGAGCTGAAGCGGTCTGCTTCAAGAATGGCAGCGTGGCGACAA
TCGGTCCGCGAGGAAATCACCCAAAAGCGAAATCCTTTGGCCATGCAGTCCCCGCCCCTCAGCCCAGCTGGTCCC
CCCGACCAACGGCGCACATGGAGCTCTGTGCAGCAGATGCGCGAGGCTTCGTCTGCTCAGCTGGGCAATGCCATC
GCAGACGGCATGCAGCGTGGCAACATGACGGATCTGCACCGACAGGCAATGCGACAAGCATACTGTTACCCACGT
GGCCAACAATTCATAAACCGGCCTCCAACCAATCGCGCCTCCGTGGAGTCAACTCCGTCATTCGTTCGCGCCCAG
CGGCGACAGTGCGTTCCGATCTCAGGCCCGCCGTCGCTCCTCCGCCCACCAGCAGTCCGACTCGCAAACCCAGTC
AACCACGTCCCACGAATAACCCCCATAACCGTCCGCCCCCAACAATCCGACGAGAGTCTCCCACTCAGCTTCGAC
CACTCACGCGACGTCCACCCCCTCCTCAGCGTCCCAGAGCGACGCCGCTCCCGCCTAAGCCCATCCCCGAACAGC
CTACTCGTCGAGCGCAGCCAGGGGGAAACAGAAAGTGGCCGGACGAGCATTGCCCTGCCCCGACGACACCGTCGC
AGCGAAGAGTTCACAGAAATGACGGCCGCGTTCGCGGGCAGCGCAGCGCGCGAAACAGAGAACCTGCGCCCTCCC
GAAGCTGTCCACCTCACACAGAGCGGCACCCGACAGAACGACCGTTTCCGCTACACCCAGTCACAAACTTCCTTC
CACTCCCAGTCCCAGTCCCAGTCCCAGATCGCTTCCGTCCCGTCGCATACTGGGTACCCGCATGCCGATGTCGCT
GAGGAGCTCGCCTGGGGCCCTGCTCACCCCTGTTTTCCGCATATTAATCCCCATGTGCCTCTCGGGTCGCGGGAG
TACCTCACAACGCGCGTGATTCGCATCCGGCGAGATTGGATGATCAAGGGTGATTTGGCGCCGACATTTTCGAAT
TTGTATCCCGAGATCCTTGATCCGTTGTTGTCGGAGCAGGAGTTTCGCCGGGTTATCTCTACCGTCAATGATGGT
GTTATCAAGGCGTTTGATCCGTTCAGTTTTCGGAATTGGTTCGATAGCACGATGGGTTTGTTGACGGGCTGGGTA
TGGGATGATATCAATGCCCCCGCGACCAAAAGCCAGTTGCAGCGTGTCGAGGCTTGGTTGGAGAATTGGAACCGC
GAGGTCGGTGCCAAAGATGGTGTTCATATCTGGAGCTTGAGGCGGACGGCCTATATGTCGCTTGATATCCAGATT
CCCGATCCCAAGGTTGGCATTGTACCCAGTGAAGCCCCTTCAGCTGCTAATACCAGGCCGAGTACTGGTATTGGG
GCTGGCTCTTGA
Transcript >Pro_DTO070G2_2|g7106.t1
ATGCGGTGGTCTTTTATATTCGTCTTAATAGTGTCCCTGTTTCTACTAGGGACATTGGCAGCGCCAGCTTCGCCC
GCGGGACGACGCAATGTTGCATTCGCCAACTTGGAGGTCAGACAGGAAAAGGAAACGGATTCTACAAAGACAGAT
GCTGCCAGTGAGACTACGACGGCAACACAAACAGATACATCAAAAACAACAACCGAGGCATCAACATCTGTCGAA
ACTACAACGACAGGCGCTACTACCTCGAGTACTGACTCGACTACTACAACGCATGCGACAACGCATGCCACAACA
ACGACTTCTGCCGCTTCTGCTACCTCCACTGTACCTTCGCTCGACGGAGCAACTGAATCTTCTCAACAGGAAGCA
GCAGACTCCAGTAGGCCGACCTACTCCGGTGGTCTGCCAATCAAACCAGTGATCACGCCGGCATGGGGTGTTGGG
GGAGTTATACTTATTGCCCTCGGGGCTGTTCTGGCTTTCATTGGTGTCCGGCAACAATGGGTCCAAATCTTCCTC
TCAACCGGATTTCTTAGCGCATTGGGAGTTACCGTCCTTATTATCTATGTGATGAGCCCACCGGTCAGCAATGCT
GTACAGGGCGGTTACCTCGTCGCTGTCTTCTTCACCGGCGTTGTGTTCGGTGCTTTATCGCTCGTCTTCAGAGAG
ATATGCGAGGGACTGGGCTGTCTTCTGGGCGGTTTCTGCCTGAGCATGTGGTTCCTTGCCTTGAAATCCGGCGGC
CTTGTAACCGAAAGTGGCTCCAGGGTCGGTATGATCATTGCCTTTACTGTAGGTTTCTACTGCCTGTCATTCAGC
CATTATACCCGATCATACGGGTTGATCGGTTGCACATCATTCGCCGGTGCAACTGCCTTAGTCCTTGGAATCGAT
TGCTTTAGCAGAGCTGGGTTGAAGGAGTTCTGGTTATACAACTGGAACTTGAACCAAAATGTCTTCCCTCTTAAC
ACGGACACTTACCCCGTGACACGTGGTATTCGTGTTGAGCTCGCCGTGACTATCATTATCGCTGTTCTAGGAGTA
ATCTCCCAGATCAGACTTTGGAATCTCATCAAGGAGCGCAGAACCAAGGAAGAAGAATCCCGCCTGGAACACACT
CGAAAGATCGAAGAAGAAGATCTCGAAATCGGTCGCCGACTCGAGGAGAAGAATATCCAAGAACGTGCTGAATGG
GAACTCATTTACGGAACCGGCAAAGCCGCCGATGGCAAAACCGCCTCGGTTTCGGAGACTGCTGTTGATGACTCG
CGACGGGGCTCGGAGGCGTTTGAGTCCTCTGACAACGACAGGGAGGGTGAGATCGAGCTCAAGGAAATCTCGAGC
CCCGATGCTTCCGGTAGTGGTTCTGATGGAGAGAAGAACCGCCAGGGTGAAAACGGTACTCGCGAACTTGAGGCT
GTGCCTGAGGAGGATTCATCCCAACAGGGTCAATCACAAGATGCAGAGGAAAAGGGCGTCGAGCAAGAGGGTCGA
TCTGAAGAAAAGGTGCCGAGACCTACCACACCTGTTATGACTCATATCCTTGGTGAGGGCAATGATGAGTCCTCT
GAGATCGGTGCTGAGATCGGCTCAGAGGTCGGCACGCCGCGCTCGAAACGGTTCTCCGGCAGAGAAATGTTGAAC
CGGATGTCTTGGCGGCTCAGCAATGGTGTTATGACGACTTCACAGTCGCAGGAGAATCTGGTGGCTCATGATGAT
GCCAGCTCTTCTGTCCTGGGGGTTGTGGATGATCTCCATGAGATGAGCGTCGGCTGTCCGAGTGTTCTATCGGAT
GCGGATGTTCACGAGCAAACGCGCGAAATTAGAGCCGAGTTATCTCCAGAGAAGGACTCGGCAGGTGTGGACATC
AAGTCAAAATCCGGCTCACAAGCCATCCAAGATGCTGGACTCCATGTCGATACAGCCATATCCCAGGATGCCGAG
AAAGTGACCACCGAAGAAGTCGATACTAGCGACACTGTTCAGCAGGTGTCTCCCGTCGAGAGCACTGTTATTGCC
AACAGTCCCCTTGAGAATTCTGGAATTTCCGAAGTGTCGGAGAAGCCACAATCGCCAGAAACCCCCGCAACAGAT
GTTCAAGCAGACATTCCAGATGCCTCAAAGAAGATCGGGGAAGTCAAGCCCAAACCTACATTGGAGCAGTCACCT
ATGAATGATGCAGAAGTGGAAAATGTGGAGGCCAATGAAGATCAACCTCCTACTGCTAAAACCATCAAGGCCGAG
TCTATTCCTGAGTCGAAGGCTGCATCTTTGCCCGAGCCCAAGGTTGAGCCAAAGATCAAAGTAATCAAAAAACTA
GATGCGTCAAGCATCAAGCACATCCCCGAGCAAACATCACGAGTGATCCATTCGTACCGGACGAACGAATGGGCC
AAGCATCTCGCAGATGCGGACACCCCTGAGATGGAGCCGCTTGAGTTCGAACCTGAACCCGAGGCAGAAGCCTCA
GAGGAAGTTCGCGAGACTGCAGCATTTGTCGATGTAGGCGGTCTTCTCCAGACGCCTCTTACTGCACAACCACCA
CCAATCGTGAACAGACCTGAATTTGATGATATGGACAATCAACAACCATACATCTCATCGACACCCTCACCAGAT
ATTCCCCGATCAAAGACACGGACAGGCACGCAAGGTCTCAGCAAAGCGAATCCAAGTCTAACCCGGAACGATTCG
ACAGCTTCGGTCAATATGCTACCATCAGCTTTTAATCCTTTCATAACCCAAGAACCGGGATTGACGTCGATGCGC
TGCGCATCGACTCCCCTGTTGACAGTCACTACTCCCAACGAGCCCAAAGAAGCAGAGCCATCATCACGCTGGAAC
GGGCCACCTCCCCTTCTCGCAATCCGCGAGAACATGGTCCGAAACCGCATGTCCTCAACATCCAACCGCTTCGAT
CCCTGGGCCGCACGCAACTTATCCCGACAGTCTCTACCTGATATGGCACCCCTCGTCTCCCCAGTAGCACCAGTA
TCACCGCCGCTCTCCATCCCGGAAGAAAAGGAGATAGAACCCGAACCCAACGAGGATGACATCCCACTTTCCAAA
CGGCGCGCCCTGCTACAGCGCCAGACAATGCGGTCTTCATCTGCATTAAGCATTGAGAATCTCCAGGCTGCCCAG
TCCCCTATGTATCCCCCGGCAGAACCCGCCGGCGAGCTGAAGCGGTCTGCTTCAAGAATGGCAGCGTGGCGACAA
TCGGTCCGCGAGGAAATCACCCAAAAGCGAAATCCTTTGGCCATGCAGTCCCCGCCCCTCAGCCCAGCTGGTCCC
CCCGACCAACGGCGCACATGGAGCTCTGTGCAGCAGATGCGCGAGGCTTCGTCTGCTCAGCTGGGCAATGCCATC
GCAGACGGCATGCAGCGTGGCAACATGACGGATCTGCACCGACAGGCAATGCGACAAGCATACTGTTACCCACGT
GGCCAACAATTCATAAACCGGCCTCCAACCAATCGCGCCTCCGTGGAGTCAACTCCGTCATTCGTTCGCGCCCAG
CGGCGACAGTGCGTTCCGATCTCAGGCCCGCCGTCGCTCCTCCGCCCACCAGCAGTCCGACTCGCAAACCCAGTC
AACCACGTCCCACGAATAACCCCCATAACCGTCCGCCCCCAACAATCCGACGAGAGTCTCCCACTCAGCTTCGAC
CACTCACGCGACGTCCACCCCCTCCTCAGCGTCCCAGAGCGACGCCGCTCCCGCCTAAGCCCATCCCCGAACAGC
CTACTCGTCGAGCGCAGCCAGGGGGAAACAGAAAGTGGCCGGACGAGCATTGCCCTGCCCCGACGACACCGTCGC
AGCGAAGAGTTCACAGAAATGACGGCCGCGTTCGCGGGCAGCGCAGCGCGCGAAACAGAGAACCTGCGCCCTCCC
GAAGCTGTCCACCTCACACAGAGCGGCACCCGACAGAACGACCGTTTCCGCTACACCCAGTCACAAACTTCCTTC
CACTCCCAGTCCCAGTCCCAGTCCCAGATCGCTTCCGTCCCGTCGCATACTGGGTACCCGCATGCCGATGTCGCT
GAGGAGCTCGCCTGGGGCCCTGCTCACCCCTGTTTTCCGCATATTAATCCCCATGTGCCTCTCGGGTCGCGGGAG
TACCTCACAACGCGCGTGATTCGCATCCGGCGAGATTGGATGATCAAGGGTGATTTGGCGCCGACATTTTCGAAT
TTGTATCCCGAGATCCTTGATCCGTTGTTGTCGGAGCAGGAGTTTCGCCGGGTTATCTCTACCGTCAATGATGGT
GTTATCAAGGCGTTTGATCCGTTCAGTTTTCGGAATTGGTTCGATAGCACGATGGGTTTGTTGACGGGCTGGGTA
TGGGATGATATCAATGCCCCCGCGACCAAAAGCCAGTTGCAGCGTGTCGAGGCTTGGTTGGAGAATTGGAACCGC
GAGGTCGGTGCCAAAGATGGTGTTCATATCTGGAGCTTGAGGCGGACGGCCTATATGTCGCTTGATATCCAGATT
CCCGATCCCAAGGTTGGCATTGTACCCAGTGAAGCCCCTTCAGCTGCTAATACCAGGCCGAGTACTGGTATTGGG
GCTGGCTCTTGA
Gene >Pro_DTO070G2_2|g7106.t1
ATGCGGTGGTCTTTTATATTCGTCTTAATAGTGTCCCTGTTTCTACTAGGGACATTGGCAGCGCCAGCTTCGCCC
GCGGGACGACGCAATGTTGCATTCGCCAACTTGGAGGTCAGACAGGAAAAGGAAACGGATTCTACAAAGACAGAT
GCTGCCAGTGAGACTACGACGGCAACACAAACAGATACATCAAAAACAACAACCGAGGCATCAACATCTGTCGAA
ACTACAACGACAGGCGCTACTACCTCGAGTACTGACTCGACTACTACAACGCATGCGACAACGCATGCCACAACA
ACGACTTCTGCCGCTTCTGCTACCTCCACTGTACCTTCGCTCGACGGAGCAACTGAATCTTCTCAACAGGAAGCA
GCAGACTCCAGTAGGCCGACCTACTCCGGTGGTCTGCCAATCAAACCAGTGATCACGCCGGCATGGGGTGTTGGG
GGAGTTATACTTATTGCCCTCGGGGCTGTTCTGGCTTTCATTGGTGTCCGGCAACAATGGTATTTAAGCTACGAT
TCTTTGATGACAATAGCATTTTCTAACAAAGAAAAGGGTCCAAATCTTCCTCTCAACCGGATTTCTTAGCGCATT
GGGAGTTACCGTAAGTTCTATACTCGAAAATAGCAAAGAGCAAAAACTAACCAACTCTCATACAGGTCCTTATTA
TCTATGTGATGAGCCCACCGGTCAGCAATGCTGTACAGGGCGGTTACCTCGTCGCTGTCTTCTTCACCGGCGTTG
TGTTCGGTGCTTTATCGCTCGTCTTCAGAGAGATATGCGAGGGACTGGGCTGTCTTCTGGGCGGTTTCTGCCTGA
GCATGTGGTTCCTTGCCTTGAAATCCGGCGGCCTTGTAACCGAAAGTGGCTCCAGGGTCGGTATGATCATTGCCT
TTACTGTAGGTTTCTACTGCCTGTCATTCAGCCATTATACCCGATCATACGGGTTGATCGGTTGCACATCATTCG
CCGGTGCAACTGCCTTAGTCCTTGGAATCGATTGCTTTAGCAGAGCTGGGTTGAAGGAGTTCTGGTTATACAACT
GGAGTAAGTCTAACAATTTTTCCCAACTGTTGATAGTTGCTGACAGACCCAGACTTGAACCAAAATGTCTTCCCT
CTTAACACGGACACTTACCCCGTGACACGTGGTATTCGTGTTGAGCTCGCCGTGACTATCATTATCGCTGTTCTA
GGAGTAATCTCCCAGATCAGACTTTGGAATCTCATCAAGGAGCGCAGAACCAAGGAAGAAGAATCCCGCCTGGAA
CACACTCGAAAGATCGAAGAAGAAGATCTCGAAATCGGTCGCCGACTCGAGGAGAAGAATATCCAAGAACGTGCT
GAATGGGAACTCATTTACGGAACCGGCAAAGCCGCCGATGGCAAAACCGCCTCGGTTTCGGAGACTGCTGTTGAT
GACTCGCGACGGGGCTCGGAGGCGTTTGAGTCCTCTGACAACGACAGGGAGGGTGAGATCGAGCTCAAGGAAATC
TCGAGCCCCGATGCTTCCGGTAGTGGTTCTGATGGAGAGAAGAACCGCCAGGGTGAAAACGGTACTCGCGAACTT
GAGGCTGTGCCTGAGGAGGATTCATCCCAACAGGGTCAATCACAAGATGCAGAGGAAAAGGGCGTCGAGCAAGAG
GGTCGATCTGAAGAAAAGGTGCCGAGACCTACCACACCTGTTATGACTCATATCCTTGGTGAGGGCAATGATGAG
TCCTCTGAGATCGGTGCTGAGATCGGCTCAGAGGTCGGCACGCCGCGCTCGAAACGGTTCTCCGGCAGAGAAATG
TTGAACCGGATGTCTTGGCGGCTCAGCAATGGTGTTATGACGACTTCACAGTCGCAGGAGAATCTGGTGGCTCAT
GATGATGCCAGCTCTTCTGTCCTGGGGGTTGTGGATGATCTCCATGAGATGAGCGTCGGCTGTCCGAGTGTTCTA
TCGGATGCGGATGTTCACGAGCAAACGCGCGAAATTAGAGCCGAGTTATCTCCAGAGAAGGACTCGGCAGGTGTG
GACATCAAGTCAAAATCCGGCTCACAAGCCATCCAAGATGCTGGACTCCATGTCGATACAGCCATATCCCAGGAT
GCCGAGAAAGTGACCACCGAAGAAGTCGATACTAGCGACACTGTTCAGCAGGTGTCTCCCGTCGAGAGCACTGTT
ATTGCCAACAGTCCCCTTGAGAATTCTGGAATTTCCGAAGTGTCGGAGAAGCCACAATCGCCAGAAACCCCCGCA
ACAGATGTTCAAGCAGACATTCCAGATGCCTCAAAGAAGATCGGGGAAGTCAAGCCCAAACCTACATTGGAGCAG
TCACCTATGAATGATGCAGAAGTGGAAAATGTGGAGGCCAATGAAGATCAACCTCCTACTGCTAAAACCATCAAG
GCCGAGTCTATTCCTGAGTCGAAGGCTGCATCTTTGCCCGAGCCCAAGGTTGAGCCAAAGATCAAAGTAATCAAA
AAACTAGATGCGTCAAGCATCAAGCACATCCCCGAGCAAACATCACGAGTGATCCATTCGTACCGGACGAACGAA
TGGGCCAAGCATCTCGCAGATGCGGACACCCCTGAGATGGAGCCGCTTGAGTTCGAACCTGAACCCGAGGCAGAA
GCCTCAGAGGAAGTTCGCGAGACTGCAGCATTTGTCGATGTAGGCGGTCTTCTCCAGACGCCTCTTACTGCACAA
CCACCACCAATCGTGAACAGACCTGAATTTGATGATATGGACAATCAACAACCATACATCTCATCGACACCCTCA
CCAGATATTCCCCGATCAAAGACACGGACAGGCACGCAAGGTCTCAGCAAAGCGAATCCAAGTCTAACCCGGAAC
GATTCGACAGCTTCGGTCAATATGCTACCATCAGCTTTTAATCCTTTCATAACCCAAGAACCGGGATTGACGTCG
ATGCGCTGCGCATCGACTCCCCTGTTGACAGTCACTACTCCCAACGAGCCCAAAGAAGCAGAGCCATCATCACGC
TGGAACGGGCCACCTCCCCTTCTCGCAATCCGCGAGAACATGGTCCGAAACCGCATGTCCTCAACATCCAACCGC
TTCGATCCCTGGGCCGCACGCAACTTATCCCGACAGTCTCTACCTGATATGGCACCCCTCGTCTCCCCAGTAGCA
CCAGTATCACCGCCGCTCTCCATCCCGGAAGAAAAGGAGATAGAACCCGAACCCAACGAGGATGACATCCCACTT
TCCAAACGGCGCGCCCTGCTACAGCGCCAGACAATGCGGTCTTCATCTGCATTAAGCATTGAGAATCTCCAGGCT
GCCCAGTCCCCTATGTATCCCCCGGCAGAACCCGCCGGCGAGCTGAAGCGGTCTGCTTCAAGAATGGCAGCGTGG
CGACAATCGGTCCGCGAGGAAATCACCCAAAAGCGAAATCCTTTGGCCATGCAGTCCCCGCCCCTCAGCCCAGCT
GGTCCCCCCGACCAACGGCGCACATGGAGCTCTGTGCAGCAGATGCGCGAGGCTTCGTCTGCTCAGCTGGGCAAT
GCCATCGCAGACGGCATGCAGCGTGGCAACATGACGGATCTGCACCGACAGGCAATGCGACGTATGCAGGCCTCA
GCAAATCGAAAGCTGTAGTACCTATGGTTCATTCATTTTTCTCAATACCCCTTGATTTGGTTCTTTTTTACCAAG
CGTTGTTATTACACGCCATGGCGAATGTGTGTTTCCTACGACTTTATGAAGTATTTATTGCATCAATGTCTATAA
TCTTATTTGATAATGTATATCTTTGCCCAATTCGCGCCATGCAAGTAATACGGCCTCACCGAGCACTGCCGAGAC
TTGGTCTGAATTGAAATGCAGTTCGTCATATCGCAGTGCATGGTGACTACTAGGGTTCCTATTGGCTTTTAAGGG
GAATCGGTCGTAGCCTATAGAATAGGATGAAGACTATGACTCTACGGAGTAATAAGTCGGAAGATCTTATGGCCA
ATTTCCGTTGGTAATAAGAGCTAAGAGGACCAAAGTCCCTAACGGTCCTTATGCACTGCGATAGTCATCCCTAAT
AGTGCAATAGTACGTCTATTAGCGTTTGCTAGAGTGTGCATACTACCAATAAAGGCCGAGATGAAACAAGGGACG
GTGGATTCATCACAGTGAAACCGGGGGCAAACGACTTGCATATCAATTATTATATTATTGGACGTATATCCCTTT
CGAGTCTCTGTCATTTTGATATAAGATATAAGATGCAAGATCCTTCTTCAAGTCTGAATTCCGGTTTCTGTCTAT
TTAGCAAAAGTCGAGACTCATATACGCCAAGCTAGCTGCTTCTATAAGATTTACAAGGATTTTGTCTCAAATTTC
ACCTACAAATTCAAACCTTCTTTCTTTTCCCTAATTCTTTTCTAATATCATTTCTCACACTCATTTTGCTGTATG
TCCACATAGGGCACTGTTCTCTTGGCCGATCTCCATCTCCGCTCCAGTTTCCCCCCTCTCCTTTCTCCCCTCAAA
ACGGCGTCCTTAATAGTCCCCAGACCTCTGTCGAGGGAGGAAGAAGCATACTGTTACCCACGTGGCCAACAATTC
ATAAACCGGCCTCCAACCAATCGCGCCTCCGTGGAGTCAACTCCGTCATTCGTTCGCGCCCAGCGGCGACAGTGC
GTTCCGATCTCAGGCCCGCCGTCGCTCCTCCGCCCACCAGCAGTCCGACTCGCAAACCCAGTCAACCACGTCCCA
CGAATAACCCCCATAACCGTCCGCCCCCAACAATCCGACGAGAGTCTCCCACTCAGCTTCGACCACTCACGCGAC
GTCCACCCCCTCCTCAGCGTCCCAGAGCGACGCCGCTCCCGCCTAAGCCCATCCCCGAACAGCCTACTCGTCGAG
CGCAGCCAGGGGGAAACAGAAAGTGGCCGGACGAGCATTGCCCTGCCCCGACGACACCGTCGCAGCGAAGAGTTC
ACAGAAATGACGGCCGCGTTCGCGGGCAGCGCAGCGCGCGAAACAGAGAACCTGCGCCCTCCCGAAGCTGTCCAC
CTCACACAGAGCGGCACCCGACAGAACGACCGTTTCCGCTACACCCAGTCACAAACTTCCTTCCACTCCCAGTCC
CAGTCCCAGTCCCAGATCGCTTCCGTCCCGTCGCATACTGGGTACCCGCATGCCGATGTCGCTGAGGAGCTCGCC
TGGGGCCCTGCTCACCCCTGTTTTCCGCATATTAATCCCCATGTGCCTCTCGGGTCGCGGGAGTACCTCACAACG
CGCGTGATTCGCATCCGGCGAGATTGGATGATCAAGGGTGATTTGGCGCCGACATTTTCGAATTTGTATCCCGAG
ATCCTTGATCCGTTGTTGTCGGAGCAGGAGTTTCGCCGGGTTATCTCTACCGTCAATGATGGTGTTATCAAGGCG
TTTGATCCGTTCAGTTTTCGGAATTGGTTCGATAGCACGATGGGTTTGTTGACGGGCTGGGTATGGGATGATATC
AATGCCCCCGCGACCAAAAGCCAGTTGCAGCGTGTCGAGGCTTGGTTGGAGAATTGGAACCGCGAGGTCGGTGCC
AAAGATGGTGTTCATATCTGGAGCTTGAGGCGGACGGCCTATATGTCGCTTGATATCCAGATTCCCGATCCCAAG
GTTGGCATTGTACCCAGTGAAGCCCCTTCAGCTGCTAATACCAGGCCGAGTACTGGTATTGGGGCTGGCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail