Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g705.t1
Gene name
Locationscaffold_01:1839209..1840871
Strand-
Gene length (bp)1662
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08288 PIGA PIGA (GPI anchor biosynthesis) 5.7E-46 42 131
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 4.1E-28 17 180
PF00534 Glycos_transf_1 Glycosyl transferases group 1 1.3E-26 214 349
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 6.8E-24 219 355
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 1.0E-11 17 178

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0006796 phosphate-containing compound metabolic process No
GO:0019538 protein metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:0016740 transferase activity No
GO:0006650 glycerophospholipid metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0009247 glycolipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0003824 catalytic activity No
GO:0046467 membrane lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008150 biological_process No
GO:0006629 lipid metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006497 protein lipidation No
GO:0006664 glycolipid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 432 454 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT4 5.0E-35 216 362

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup6483
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g7104.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g575.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g1353.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g8904.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g7021.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g7172.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g332.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g4761.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g4968.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g8151.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g8491.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g2123.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g6341.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g6691.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g2829.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g1655.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g5772.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g7939.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g705.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g763.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g1545.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g1974.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g8189.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g5838.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g4185.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g1213.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g3471.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g4431.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g1031.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g64.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g4680.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g8312.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g3916.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g897.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g705.t1
MPYNIAMVSDFFFPQSGGIESHIYQLSSKLIDRGHKVIVITHAYKGRTGVRYLTNGLKIYHVPFFVIYRETTFPT
VFSFFPIFRNIVIREEIDIVHGHASLSSFCGEAILHARTMGLRTVFTDHSLFGFADAASILTNKLLKFTLSDVDH
AICVSHTCKENTVLRASLDPLMVSVIPNAVVAENFCPLSHTTRAPDQGLSSPADAPMSPRQIGPDDPITIVVISR
LFYNKGTDLLIASIPRILASNPNTRFIIAGSGPKAIDLEQMLERNVLQDKVELLGSVRHEEVRDVMVRGDIYLHP
SLTEAFGTVIVEAASCGLYVVCTRVGGIPEVLPQHMTTFAKPEEDDIVLATSKAIAALRSNKVRTDRFHDQVKMM
YSWRDVAARTERVYEGITGDISPEEFYGYYPGQGWEASGDRVRSFALIDRLKRYYGCGVWAGKLFCLCVVIDFLI
YVFLEMWFPRANIDIARSWPKKQPASKTESTRSGR*
Coding >Pro_DTO070G2_2|g705.t1
ATGCCGTATAACATCGCAATGGTCAGTGACTTCTTTTTTCCCCAGTCAGGTGGAATTGAGAGTCACATATACCAA
TTGTCATCTAAACTCATTGATCGAGGACACAAAGTCATCGTTATTACCCATGCATACAAAGGACGCACCGGAGTC
CGCTACCTCACCAATGGACTGAAGATTTACCACGTCCCATTCTTCGTCATCTATCGCGAAACGACATTCCCAACA
GTCTTCTCCTTCTTCCCCATATTCCGCAATATCGTCATCCGAGAGGAGATTGACATAGTTCACGGCCATGCCAGT
TTGAGTAGCTTCTGTGGAGAAGCTATTCTCCATGCGCGTACTATGGGACTGCGGACTGTCTTCACAGACCATTCT
CTCTTCGGATTTGCTGACGCAGCATCCATCCTCACCAACAAATTACTCAAGTTTACATTGAGTGATGTTGATCAT
GCGATTTGCGTTAGTCATACTTGCAAGGAAAACACAGTCCTTCGGGCTTCGTTGGATCCATTAATGGTGTCAGTC
ATTCCAAACGCGGTTGTGGCGGAGAATTTCTGTCCTCTATCTCATACTACTCGTGCACCTGATCAGGGCCTGAGC
TCCCCCGCCGATGCTCCAATGTCCCCGAGACAAATTGGGCCCGATGATCCGATTACAATCGTGGTCATCTCCCGA
CTTTTTTACAATAAGGGCACTGATCTTCTCATCGCATCTATTCCGCGGATTCTTGCCTCCAATCCCAACACTCGC
TTCATTATCGCAGGATCAGGACCTAAAGCGATCGACCTAGAGCAGATGCTGGAACGCAATGTGCTTCAGGATAAA
GTCGAACTTTTAGGTTCGGTCCGACACGAGGAGGTCCGAGACGTGATGGTGCGAGGTGATATTTATCTCCATCCT
AGTCTGACAGAGGCATTCGGGACAGTCATTGTTGAAGCTGCTAGTTGTGGTCTTTACGTGGTCTGTACCCGTGTT
GGAGGCATTCCAGAAGTTTTACCCCAGCATATGACAACGTTCGCCAAACCGGAGGAGGATGATATTGTGCTTGCA
ACCAGCAAGGCAATTGCGGCTTTGCGTTCGAACAAAGTGCGGACGGACCGATTTCATGATCAAGTGAAGATGATG
TATTCATGGCGAGACGTAGCCGCCCGGACTGAGCGCGTGTACGAGGGCATTACTGGCGATATTAGTCCAGAAGAA
TTCTATGGTTACTATCCAGGTCAGGGCTGGGAAGCGAGCGGAGATCGCGTCCGCAGCTTTGCGCTAATTGACCGG
CTAAAACGTTACTACGGCTGTGGCGTTTGGGCAGGCAAGCTCTTCTGCCTGTGTGTCGTGATTGACTTCTTGATC
TATGTCTTCCTTGAGATGTGGTTTCCCCGAGCCAACATTGATATCGCACGAAGCTGGCCAAAGAAGCAGCCAGCG
AGCAAAACTGAGAGCACCAGAAGTGGTCGCTGA
Transcript >Pro_DTO070G2_2|g705.t1
ATGCCGTATAACATCGCAATGGTCAGTGACTTCTTTTTTCCCCAGTCAGGTGGAATTGAGAGTCACATATACCAA
TTGTCATCTAAACTCATTGATCGAGGACACAAAGTCATCGTTATTACCCATGCATACAAAGGACGCACCGGAGTC
CGCTACCTCACCAATGGACTGAAGATTTACCACGTCCCATTCTTCGTCATCTATCGCGAAACGACATTCCCAACA
GTCTTCTCCTTCTTCCCCATATTCCGCAATATCGTCATCCGAGAGGAGATTGACATAGTTCACGGCCATGCCAGT
TTGAGTAGCTTCTGTGGAGAAGCTATTCTCCATGCGCGTACTATGGGACTGCGGACTGTCTTCACAGACCATTCT
CTCTTCGGATTTGCTGACGCAGCATCCATCCTCACCAACAAATTACTCAAGTTTACATTGAGTGATGTTGATCAT
GCGATTTGCGTTAGTCATACTTGCAAGGAAAACACAGTCCTTCGGGCTTCGTTGGATCCATTAATGGTGTCAGTC
ATTCCAAACGCGGTTGTGGCGGAGAATTTCTGTCCTCTATCTCATACTACTCGTGCACCTGATCAGGGCCTGAGC
TCCCCCGCCGATGCTCCAATGTCCCCGAGACAAATTGGGCCCGATGATCCGATTACAATCGTGGTCATCTCCCGA
CTTTTTTACAATAAGGGCACTGATCTTCTCATCGCATCTATTCCGCGGATTCTTGCCTCCAATCCCAACACTCGC
TTCATTATCGCAGGATCAGGACCTAAAGCGATCGACCTAGAGCAGATGCTGGAACGCAATGTGCTTCAGGATAAA
GTCGAACTTTTAGGTTCGGTCCGACACGAGGAGGTCCGAGACGTGATGGTGCGAGGTGATATTTATCTCCATCCT
AGTCTGACAGAGGCATTCGGGACAGTCATTGTTGAAGCTGCTAGTTGTGGTCTTTACGTGGTCTGTACCCGTGTT
GGAGGCATTCCAGAAGTTTTACCCCAGCATATGACAACGTTCGCCAAACCGGAGGAGGATGATATTGTGCTTGCA
ACCAGCAAGGCAATTGCGGCTTTGCGTTCGAACAAAGTGCGGACGGACCGATTTCATGATCAAGTGAAGATGATG
TATTCATGGCGAGACGTAGCCGCCCGGACTGAGCGCGTGTACGAGGGCATTACTGGCGATATTAGTCCAGAAGAA
TTCTATGGTTACTATCCAGGTCAGGGCTGGGAAGCGAGCGGAGATCGCGTCCGCAGCTTTGCGCTAATTGACCGG
CTAAAACGTTACTACGGCTGTGGCGTTTGGGCAGGCAAGCTCTTCTGCCTGTGTGTCGTGATTGACTTCTTGATC
TATGTCTTCCTTGAGATGTGGTTTCCCCGAGCCAACATTGATATCGCACGAAGCTGGCCAAAGAAGCAGCCAGCG
AGCAAAACTGAGAGCACCAGAAGTGGTCGCTGA
Gene >Pro_DTO070G2_2|g705.t1
ATGCCGTATAACATCGCGTGAGTATTTGTTCTATCTACTAGTCGCAATCACTTGCTAACATTGATATGGTTATAG
AATGGTCAGTGACTTCTTTTTTCCCCAGTCAGGTAAGCCTCTTCTTTTACGTGTAGTTTATACAATCGCTGACTT
TTCTAGGTGGAATTGAGAGTCACATATACCAATTGTCATCTGTAAGCACGCTACCTTGCCGCTCTACCTGCGCTC
TCTAATTGCTCCTCAGAAACTCATTGATCGAGGACACAAAGTCATCGTTATTACCCATGCATACAAAGGACGCAC
CGGAGTCCGCTACCTCACCAATGGACTGAAGATTTACCACGTCCCATTCTTCGTCATCTATCGCGAAACGACATT
CCCAACAGTCTTCTCCTTCTTCCCCATATTCCGCAATATCGTCATCCGAGAGGAGATTGACATAGTTCACGGCCA
TGCCAGTTTGAGTAGCTTCTGTGGAGAAGCTATTCTCCATGCGCGTACTATGGGACTGCGGACTGTCTTCACAGA
CCATTCTCTCTTCGGATTTGCTGACGCAGCATCCATCCTCACCAACAAATTACTCAAGTTTACATTGAGTGATGT
TGATCATGCGATTTGCGTTAGTCATACTTGGTAAGTCTCCCGCCAACGCCCTGGATGACTCAACTGACAAGTTTC
AGCAAGGAAAACACAGTCCTTCGGGCTTCGTTGGATCCATTAATGGTGTCAGTCATTCCAAACGCGGTTGTGGCG
GAGAATTTCTGTCCTCTATCTCATACTACTCGTGCACCTGATCAGGGCCTGAGCTCCCCCGCCGATGCTCCAATG
TCCCCGAGACAAATTGGGCCCGATGATCCGATTACAATCGTGGTCATCTCCCGACTTTTTTACAATAAGGGCACT
GATCTTCTCATCGCATCTATTCCGCGGATTCTTGCCTCCAATCCCAACACTCGCTTCATTATCGCAGGATCAGGA
CCTAAAGCGATCGACCTAGAGCAGATGCTGGAACGCAATGTGCTTCAGGATAAAGTCGAACTTTTAGGTTCGGTC
CGACACGAGGAGGTCCGAGACGTGATGGTGCGAGGTGATATTTATCTCCATCCTAGTCTGACAGAGGCATTCGGG
ACAGTCATTGTTGAAGCTGCTAGTTGTGGTCTTTACGTGGTCTGTACCCGTGTTGGAGGCATTCCAGAAGTTTTA
CCCCAGCATATGACAACGTTCGCCAAACCGGAGGAGGATGATATTGTGCTTGCAACCAGCAAGGCAATTGCGGCT
TTGCGTTCGAACAAAGTGCGGACGGACCGATTTCATGATCAAGTGAAGATGATGTATTCATGGCGAGACGTAGCC
GCCCGGACTGAGCGCGTGTACGAGGGCATTACTGGCGATATTAGTCCAGAAGAATTCTATGGTTACTATCCAGGT
CAGGGCTGGGAAGCGAGCGGAGATCGCGTCCGCAGCTTTGCGCTAATTGACCGGCTAAAACGTTACTACGGCTGT
GGCGTTTGGGCAGGCAAGCTCTTCTGCCTGTGTGTCGTGATTGACTTCTTGATCTATGTCTTCCTTGAGATGTGG
TTTCCCCGAGCCAACATTGATATCGCACGAAGCTGGCCAAAGAAGCAGCCAGCGAGCAAAACTGAGAGCACCAGA
AGTGGTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail