Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6958.t1
Gene name
Locationscaffold_11:177542..178631
Strand-
Gene length (bp)1089
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.1E-63 99 311
PF20434 BD-FAE BD-FAE 5.2E-16 93 188
PF00326 Peptidase_S9 Prolyl oligopeptidase family 8.1E-11 147 309
PF00135 COesterase Carboxylesterase family 1.6E-06 85 138
PF10340 Say1_Mug180 Steryl acetyl hydrolase 2.8E-05 93 246
PF07224 Chlorophyllase Chlorophyllase 1.3E-04 65 202

GO

GO Term Description Terminal node
GO:0015996 chlorophyll catabolic process Yes
GO:0008236 serine-type peptidase activity Yes
GO:0047746 chlorophyllase activity Yes
GO:0006508 proteolysis Yes
GO:0016787 hydrolase activity Yes
GO:0033013 tetrapyrrole metabolic process No
GO:0008150 biological_process No
GO:1901361 organic cyclic compound catabolic process No
GO:0017171 serine hydrolase activity No
GO:0008152 metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0042440 pigment metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0006778 porphyrin-containing compound metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0044248 cellular catabolic process No
GO:1901575 organic substance catabolic process No
GO:0009056 catabolic process No
GO:0046149 pigment catabolic process No
GO:0033015 tetrapyrrole catabolic process No
GO:0006787 porphyrin-containing compound catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0015994 chlorophyll metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6958.t1
MTAGITEPPYPLHESVKDLLHPEYVAFYNEHVINNQQVHLRPVEASRTSGVLIPGAGPMLEVGKTQDITVQRRAT
EGPPVPIRCFTPKGEAPPGGWPVMLYFHGGGWVLGNIDTENVVCSNLCVRGNCVVITVDYRLAPENRWPAAVHDC
WEVFLWLIADGPAALPVDVSKLATGGSSAGGNLAVIITHKALTLSPPVHFLAQLLSVPVTDNTATVENNESYRRY
EWTPALPALKMYWYRDHYVPNDADRTHPESSPLFWDGDYSQLPPALVMVGELDVLRSEGEQYAEKLQKAGVPVDL
QVMPGMPHPFLAMDGALSEGKRCITLMCDALQKAFWGR*
Coding >Pro_DTO070G2_2|g6958.t1
ATGACTGCCGGCATTACTGAACCACCTTACCCGCTCCACGAGTCTGTCAAAGACTTGTTGCACCCGGAGTATGTC
GCATTCTATAACGAGCATGTCATCAATAACCAGCAAGTGCACCTTCGGCCCGTGGAAGCGTCACGGACAAGTGGT
GTCTTGATTCCTGGTGCAGGTCCTATGCTGGAGGTTGGCAAGACTCAAGACATTACTGTTCAGCGGCGAGCTACC
GAGGGCCCACCAGTGCCCATCCGCTGCTTTACTCCCAAGGGCGAAGCGCCTCCTGGTGGATGGCCGGTGATGTTG
TATTTCCACGGTGGTGGCTGGGTGCTGGGTAACATCGACACGGAAAATGTGGTGTGCTCGAATCTCTGTGTACGA
GGCAACTGCGTCGTGATTACAGTGGACTACCGTCTTGCACCCGAAAACCGTTGGCCGGCCGCAGTCCATGACTGT
TGGGAAGTCTTCCTCTGGTTGATTGCCGACGGCCCCGCCGCACTCCCAGTGGACGTATCCAAACTCGCAACCGGC
GGCTCCTCCGCGGGCGGAAACCTTGCCGTGATTATCACGCACAAGGCACTGACTCTGTCACCGCCTGTTCACTTC
CTCGCTCAGCTGCTCTCGGTTCCCGTGACAGACAACACTGCCACAGTAGAGAACAACGAGTCATATCGTCGATAC
GAATGGACCCCCGCACTCCCCGCACTTAAGATGTACTGGTACCGCGACCACTATGTCCCCAACGACGCGGACCGC
ACCCACCCAGAATCGAGCCCACTGTTCTGGGATGGAGATTACTCGCAATTGCCGCCTGCGCTGGTTATGGTTGGC
GAGCTGGATGTGCTGCGCTCGGAAGGCGAGCAGTATGCGGAGAAGTTGCAGAAGGCCGGTGTACCTGTCGACTTG
CAGGTCATGCCGGGTATGCCACATCCGTTCTTGGCTATGGATGGGGCATTGTCTGAGGGCAAGAGGTGTATCACT
CTGATGTGTGATGCGCTCCAAAAGGCCTTCTGGGGCCGTTAG
Transcript >Pro_DTO070G2_2|g6958.t1
ATGACTGCCGGCATTACTGAACCACCTTACCCGCTCCACGAGTCTGTCAAAGACTTGTTGCACCCGGAGTATGTC
GCATTCTATAACGAGCATGTCATCAATAACCAGCAAGTGCACCTTCGGCCCGTGGAAGCGTCACGGACAAGTGGT
GTCTTGATTCCTGGTGCAGGTCCTATGCTGGAGGTTGGCAAGACTCAAGACATTACTGTTCAGCGGCGAGCTACC
GAGGGCCCACCAGTGCCCATCCGCTGCTTTACTCCCAAGGGCGAAGCGCCTCCTGGTGGATGGCCGGTGATGTTG
TATTTCCACGGTGGTGGCTGGGTGCTGGGTAACATCGACACGGAAAATGTGGTGTGCTCGAATCTCTGTGTACGA
GGCAACTGCGTCGTGATTACAGTGGACTACCGTCTTGCACCCGAAAACCGTTGGCCGGCCGCAGTCCATGACTGT
TGGGAAGTCTTCCTCTGGTTGATTGCCGACGGCCCCGCCGCACTCCCAGTGGACGTATCCAAACTCGCAACCGGC
GGCTCCTCCGCGGGCGGAAACCTTGCCGTGATTATCACGCACAAGGCACTGACTCTGTCACCGCCTGTTCACTTC
CTCGCTCAGCTGCTCTCGGTTCCCGTGACAGACAACACTGCCACAGTAGAGAACAACGAGTCATATCGTCGATAC
GAATGGACCCCCGCACTCCCCGCACTTAAGATGTACTGGTACCGCGACCACTATGTCCCCAACGACGCGGACCGC
ACCCACCCAGAATCGAGCCCACTGTTCTGGGATGGAGATTACTCGCAATTGCCGCCTGCGCTGGTTATGGTTGGC
GAGCTGGATGTGCTGCGCTCGGAAGGCGAGCAGTATGCGGAGAAGTTGCAGAAGGCCGGTGTACCTGTCGACTTG
CAGGTCATGCCGGGTATGCCACATCCGTTCTTGGCTATGGATGGGGCATTGTCTGAGGGCAAGAGGTGTATCACT
CTGATGTGTGATGCGCTCCAAAAGGCCTTCTGGGGCCGTTAG
Gene >Pro_DTO070G2_2|g6958.t1
ATGACTGCCGGCATTACTGAACCACCTTACCCGCTCCACGAGTCTGTCAAAGACTTGTTGCACCCGGAGTATGTC
GCATTCTATAACGAGCATGTCATCAATAACCAGCAAGTGCACCTTCGGCCCGTGGAAGCGTCACGGACAAGTGGT
GTCTTGATTCCTGGTGCAGGTCCTATGCTGGAGGTTGGCAAGACTCAAGACATTACTGTTCAGCGGCGAGCTACC
GAGGGCCCACCAGTGCCCATCCGCTGCTTTACTCCCAAGGGCGAAGCGCCTCCTGGTGGATGGCCGGTGATGTTG
TATTTCCACGGTGGTGGCTGGGTGCTGGGTAACATCGACACGGAAAATGTGGTGTGCTCGAATCTCTGTGTACGA
GGCAACTGCGTCGTGATTACAGTGGACTACCGGTAAGCTACCTAATCACGCCATGCATACATAACCTTGAGAAAT
TTCGGCCTAATTGTTATTCTTTCTCCTAGTCTTGCACCCGAAAACCGTTGGCCGGCCGCAGTCCATGACTGTTGG
GAAGTCTTCCTCTGGTTGATTGCCGACGGCCCCGCCGCACTCCCAGTGGACGTATCCAAACTCGCAACCGGCGGC
TCCTCCGCGGGCGGAAACCTTGCCGTGATTATCACGCACAAGGCACTGACTCTGTCACCGCCTGTTCACTTCCTC
GCTCAGCTGCTCTCGGTTCCCGTGACAGACAACACTGCCACAGTAGAGAACAACGAGTCATATCGTCGATACGAA
TGGACCCCCGCACTCCCCGCACTTAAGATGTACTGGTACCGCGACCACTATGTCCCCAACGACGCGGACCGCACC
CACCCAGAATCGAGCCCACTGTTCTGGGATGGAGATTACTCGCAATTGCCGCCTGCGCTGGTTATGGTTGGCGAG
CTGGATGTGCTGCGCTCGGAAGGCGAGCAGTATGCGGAGAAGTTGCAGAAGGCCGGTGTACCTGTCGACTTGCAG
GTCATGCCGGGTATGCCACATCCGTTCTTGGCTATGGATGGGGCATTGTCTGAGGGCAAGAGGTGTATCACTCTG
ATGTGTGATGCGCTCCAAAAGGCCTTCTGGGGCCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail