Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6856.t1
Gene name
Locationscaffold_10:688007..689749
Strand-
Gene length (bp)1742
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04139 Rad9 Rad9 1.9E-51 19 284

GO

GO Term Description Terminal node
GO:0030896 checkpoint clamp complex Yes
GO:0000077 DNA damage checkpoint signaling Yes
GO:1901987 regulation of cell cycle phase transition No
GO:0051726 regulation of cell cycle No
GO:0032991 protein-containing complex No
GO:0033554 cellular response to stress No
GO:0006950 response to stress No
GO:0009987 cellular process No
GO:0031570 DNA integrity checkpoint signaling No
GO:0005575 cellular_component No
GO:0048519 negative regulation of biological process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0048523 negative regulation of cellular process No
GO:0008150 biological_process No
GO:0007165 signal transduction No
GO:0010564 regulation of cell cycle process No
GO:0042770 signal transduction in response to DNA damage No
GO:0035556 intracellular signal transduction No
GO:0000075 cell cycle checkpoint signaling No
GO:0051716 cellular response to stimulus No
GO:0045786 negative regulation of cell cycle No
GO:0010948 negative regulation of cell cycle process No
GO:0140513 nuclear protein-containing complex No
GO:0050794 regulation of cellular process No
GO:0050896 response to stimulus No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:1901988 negative regulation of cell cycle phase transition No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6856.t1
MTSLSLSLGPLALVRLHDALICLSKFSETVAIEAEPDMLRLSALNSTKTGFASFTFEKEVFFEAYSFNSSSNDRS
GSVSLERFFCQIYNKALLSIFRGKTDRNKDTAVERCDMELHEDLQQAECRLTVKMICGLGVIKSYKLTYEPAAIQ
HAIFDKSRATSMWTADPRFLKQLIEHFSLSAEQLDMYSDSGRAVFTSFTTKITEGKEVLKHPVHTSVAADTRDFQ
EYLVEENMHVAINLKDFKAVVAHAETANATVTARYTRPCKPLQLEYGFEGINAEFTVMTRGQADSEDAPTSTRAS
IPRQTPVPIPISASRSRDTRPSVTTNTQMPPPPPRTRSIRPLNGSSTQENLSQRASADRPAASGLSMEFDSLFVP
ADDDRQWDEMKDEEEPQDILGWDASGTQDAFGATIRDAEPALLREDEPNDETGLPPTQRFSQVRQYGFFD*
Coding >Pro_DTO070G2_2|g6856.t1
ATGACGTCGCTCTCATTGTCGCTAGGCCCGTTAGCCTTGGTCCGGCTCCACGACGCCTTGATATGCCTGTCCAAA
TTCAGCGAAACAGTCGCCATCGAAGCAGAGCCTGATATGCTCCGCCTCAGTGCGCTCAATTCTACCAAGACGGGG
TTTGCCTCCTTCACGTTCGAGAAGGAGGTATTCTTTGAGGCGTATTCTTTCAATTCCAGCAGTAATGACAGAAGT
GGCAGTGTTTCGCTGGAACGATTCTTCTGCCAGATCTATAACAAAGCACTTCTCTCCATATTTCGTGGGAAAACC
GACAGAAACAAGGACACAGCTGTTGAACGCTGTGACATGGAATTGCATGAAGATCTACAGCAAGCCGAGTGTAGA
CTGACAGTGAAAATGATATGTGGACTAGGCGTGATCAAGTCATACAAGTTGACCTACGAACCAGCGGCCATTCAG
CACGCCATCTTCGACAAATCCAGAGCTACCAGCATGTGGACAGCTGATCCACGGTTCCTCAAGCAGCTCATTGAG
CACTTCAGCTTATCTGCCGAGCAGCTAGACATGTACTCCGATTCCGGCAGAGCGGTGTTCACGAGTTTTACAACA
AAGATCACCGAAGGCAAGGAAGTACTAAAACACCCTGTCCACACATCCGTTGCAGCAGACACGCGCGACTTCCAA
GAGTACTTGGTCGAAGAGAACATGCACGTCGCGATCAACCTAAAAGACTTCAAAGCCGTAGTTGCGCACGCCGAA
ACGGCAAACGCCACCGTAACAGCACGGTACACCCGACCCTGCAAGCCTCTGCAGCTGGAGTACGGATTTGAAGGC
ATCAACGCAGAATTCACAGTCATGACCCGCGGCCAGGCAGATAGCGAAGACGCCCCGACGTCAACACGAGCGTCA
ATCCCACGGCAAACGCCCGTGCCTATCCCAATCTCAGCGAGCAGGTCGCGTGATACTCGCCCATCGGTGACGACA
AATACGCAAATGCCTCCACCGCCACCGCGAACCAGATCCATCCGTCCTCTCAATGGGTCGTCTACGCAGGAGAAT
CTGAGCCAGAGGGCTAGCGCAGATCGGCCGGCGGCGTCTGGGCTTTCGATGGAATTCGATAGCCTTTTCGTGCCT
GCTGATGATGACCGGCAGTGGGATGAGATGAAGGACGAAGAGGAGCCGCAGGATATTCTTGGATGGGATGCGTCG
GGAACACAGGACGCATTCGGGGCAACTATTCGCGATGCGGAGCCTGCCTTGTTGAGAGAGGATGAGCCAAACGAT
GAGACGGGTCTCCCGCCAACACAACGTTTTTCTCAGGTTCGCCAATATGGTTTCTTCGACTGA
Transcript >Pro_DTO070G2_2|g6856.t1
ATGACGTCGCTCTCATTGTCGCTAGGCCCGTTAGCCTTGGTCCGGCTCCACGACGCCTTGATATGCCTGTCCAAA
TTCAGCGAAACAGTCGCCATCGAAGCAGAGCCTGATATGCTCCGCCTCAGTGCGCTCAATTCTACCAAGACGGGG
TTTGCCTCCTTCACGTTCGAGAAGGAGGTATTCTTTGAGGCGTATTCTTTCAATTCCAGCAGTAATGACAGAAGT
GGCAGTGTTTCGCTGGAACGATTCTTCTGCCAGATCTATAACAAAGCACTTCTCTCCATATTTCGTGGGAAAACC
GACAGAAACAAGGACACAGCTGTTGAACGCTGTGACATGGAATTGCATGAAGATCTACAGCAAGCCGAGTGTAGA
CTGACAGTGAAAATGATATGTGGACTAGGCGTGATCAAGTCATACAAGTTGACCTACGAACCAGCGGCCATTCAG
CACGCCATCTTCGACAAATCCAGAGCTACCAGCATGTGGACAGCTGATCCACGGTTCCTCAAGCAGCTCATTGAG
CACTTCAGCTTATCTGCCGAGCAGCTAGACATGTACTCCGATTCCGGCAGAGCGGTGTTCACGAGTTTTACAACA
AAGATCACCGAAGGCAAGGAAGTACTAAAACACCCTGTCCACACATCCGTTGCAGCAGACACGCGCGACTTCCAA
GAGTACTTGGTCGAAGAGAACATGCACGTCGCGATCAACCTAAAAGACTTCAAAGCCGTAGTTGCGCACGCCGAA
ACGGCAAACGCCACCGTAACAGCACGGTACACCCGACCCTGCAAGCCTCTGCAGCTGGAGTACGGATTTGAAGGC
ATCAACGCAGAATTCACAGTCATGACCCGCGGCCAGGCAGATAGCGAAGACGCCCCGACGTCAACACGAGCGTCA
ATCCCACGGCAAACGCCCGTGCCTATCCCAATCTCAGCGAGCAGGTCGCGTGATACTCGCCCATCGGTGACGACA
AATACGCAAATGCCTCCACCGCCACCGCGAACCAGATCCATCCGTCCTCTCAATGGGTCGTCTACGCAGGAGAAT
CTGAGCCAGAGGGCTAGCGCAGATCGGCCGGCGGCGTCTGGGCTTTCGATGGAATTCGATAGCCTTTTCGTGCCT
GCTGATGATGACCGGCAGTGGGATGAGATGAAGGACGAAGAGGAGCCGCAGGATATTCTTGGATGGGATGCGTCG
GGAACACAGGACGCATTCGGGGCAACTATTCGCGATGCGGAGCCTGCCTTGTTGAGAGAGGATGAGCCAAACGAT
GAGACGGGTCTCCCGCCAACACAACGTTTTTCTCAGGTTCGCCAATATGGTTTCTTCGACTGA
Gene >Pro_DTO070G2_2|g6856.t1
ATGACGTCGCTCTCATTGTCGCTAGGCCCGTTAGCCTTGGTCCGGCTCCACGACGCCTTGATATGCCTGTCCAAA
TTCAGCGAAACAGTCGCCATCGAAGCAGAGCCTGATATGGTAAGTTATCTTACTTTGGGGTGTTTGGCTCAGTCC
AAGTTTTAGAAGCCGGCAAATGAAATGTTCTGGCTAACCGTTTCCCAGCTCCGCCTCAGTGCGCTCAATTCTACC
AAGACGGGGTTTGCCTCCTTCACGTTCGAGAAGGAGGTATTCTTTGAGGCGTATTCTTTCAATTCCAGCAGTAAT
GACAGAAGTGGCAGTGTTTCGCTGGAACGATTCTTCTGCCAGATCTATAACAAAGTGAGTATAGACTTTTCACTC
TTGGAGCTGTACCCTACATATTTACTGGTTATCTTCCTTACTTTATGCTGATATAGAATACAGGCACTTCTCTCC
ATATTTCGTGGGAAAACCGACAGAAACAAGGACACAGCTGTTGAACGCTGTGACATGGAATTGCATGAAGATCTA
CAGCAAGCCGAGTGTAGACTGACAGTGAAAATGATATGTGGACTAGGTAAGATACACTTGCATAGATCTGTCTTT
TTTAGCTTTGACTGCACATCTGACACTATATCTAGGCGTGATCAAGTCATACAAGTTGACCTACGAACCAGCGGC
CATTCAGCACGCCATCTTCGACAAATCCAGAGCTACCAGCATGTGGACAGCTGATCCACGGTTCCTCAAGCAGCT
CATTGAGCACTTCAGCTTATCTGCCGAGCAGCTAGACATGTACTCCGATTCCGGCAGAGCGGTGTTCACGAGTTT
TACAACAAAGATCACCGAAGGCAAGGGTATGTCGAGTTCGCCTCCATCAAATCTCAGATGTCTAGTTAACTAACA
ACCCAAACAGAAGTACTAAAACACCCTGTCCACACATCCGTTGCAGCAGACACGCGCGACTTCCAAGAGTACTTG
GTCGAAGAGAACATGCACGTCGCGATCAACCTAAAAGACTTCAAAGCCGTAGTTGCGCACGCCGAAACGGCAAAC
GCCACCGTAACAGCACGGTACACCCGACCCTGCAAGCCTCTGCAGCTGGAGTACGGATTTGAAGGCATCAACGCA
GAATTCACAGTCATGACCCGCGGCCAGGCAGATAGCGAAGACGCCCCGACGTCAACACGAGCGTCAATCCCACGG
CAAACGCCCGTGCCTATCCCAATCTCAGCGAGCAGGTCGCGTGATACTCGCCCATCGGTGACGACAAATACGCAA
ATGCCTCCACCGCCACCGCGAACCAGATCCATCCGTCCTCTCAATGGGTCGTCTACGCAGGAGAATCTGAGCCAG
AGGGCTAGCGCAGATCGGCCGGCGGCGTCTGGGCTTTCGATGGAATTCGATAGCCTTTTCGTGCCTGCTGATGAT
GACCGGCAGTGGGATGAGATGAAGGACGAAGAGGAGCCGCAGGATATTCTTGGATGGGATGCGTCGGGAACACAG
GTATGTGGTTTTCTTTCTTCCCCAGTGGGTATAGTGGGTGGCTAAACAAACGCGCAGGACGCATTCGGGGCAACT
ATTCGCGATGCGGAGCCTGCCTTGTTGAGAGAGGATGAGCCAAACGATGAGACGGGTCTCCCGCCAACACAACGT
TTTTCTCAGGTATGTGAATTCTGGCTCTTGCGACACTTTGATAGGCGTATGCTGATAGTTGATAGGTTCGCCAAT
ATGGTTTCTTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail