Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g683.t1
Gene name
Locationscaffold_01:1797241..1797893
Strand+
Gene length (bp)652
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 9.5E-28 2 160

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0042887 amide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 59 81 22
3 105 127 22
4 140 162 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g683.t1
MVIGTLSSLGVLNWALNHITGVCTSAAVNGFTCPYSRTHFNTSLIWGAVGPRRYFSNQIGYSALLYFFIVGAILP
IPVYYMTRRYPKSLWRRVHIPLFLGGLNYLPPATGMNYGSWAVVGLTFGWLIRKRLHSWWSKYNFVLSSAMDSSV
GIAGVLIFLTIFFTGASNHFKWWGTEVYKNTCDWKGCPDLSVPKGHKFGV*
Coding >Pro_DTO070G2_2|g683.t1
ATGGTTATCGGCACGCTCTCCTCGCTCGGTGTCCTCAATTGGGCCCTGAATCACATCACCGGCGTCTGCACTAGC
GCTGCTGTTAACGGTTTCACTTGTCCTTACAGCAGAACCCACTTCAATACTTCCTTGATCTGGGGTGCAGTGGGT
CCTCGTCGTTACTTCTCAAACCAAATTGGCTATTCCGCTTTGCTTTATTTCTTCATCGTCGGTGCCATTCTACCC
ATTCCCGTCTATTATATGACCCGCCGATACCCCAAGTCACTATGGAGAAGGGTTCATATTCCCCTGTTCCTCGGT
GGGCTCAATTACTTGCCCCCTGCGACCGGAATGAATTACGGAAGCTGGGCAGTTGTCGGACTCACCTTTGGCTGG
CTCATTCGGAAGCGTCTGCATAGCTGGTGGAGTAAGTATAACTTTGTGCTGAGTTCTGCCATGGACTCGTCAGTG
GGAATTGCTGGTGTCTTGATTTTCTTGACAATTTTCTTTACTGGAGCCAGCAACCATTTCAAATGGTGGGGAACA
GAGGTTTACAAGAACACCTGCGACTGGAAAGGTTGTCCCGATCTTTCTGTACCAAAGGGCCATAAGTTCGGCGTG
TAG
Transcript >Pro_DTO070G2_2|g683.t1
ATGGTTATCGGCACGCTCTCCTCGCTCGGTGTCCTCAATTGGGCCCTGAATCACATCACCGGCGTCTGCACTAGC
GCTGCTGTTAACGGTTTCACTTGTCCTTACAGCAGAACCCACTTCAATACTTCCTTGATCTGGGGTGCAGTGGGT
CCTCGTCGTTACTTCTCAAACCAAATTGGCTATTCCGCTTTGCTTTATTTCTTCATCGTCGGTGCCATTCTACCC
ATTCCCGTCTATTATATGACCCGCCGATACCCCAAGTCACTATGGAGAAGGGTTCATATTCCCCTGTTCCTCGGT
GGGCTCAATTACTTGCCCCCTGCGACCGGAATGAATTACGGAAGCTGGGCAGTTGTCGGACTCACCTTTGGCTGG
CTCATTCGGAAGCGTCTGCATAGCTGGTGGAGTAAGTATAACTTTGTGCTGAGTTCTGCCATGGACTCGTCAGTG
GGAATTGCTGGTGTCTTGATTTTCTTGACAATTTTCTTTACTGGAGCCAGCAACCATTTCAAATGGTGGGGAACA
GAGGTTTACAAGAACACCTGCGACTGGAAAGGTTGTCCCGATCTTTCTGTACCAAAGGGCCATAAGTTCGGCGTG
TAG
Gene >Pro_DTO070G2_2|g683.t1
ATGGTTATCGGCACGCTCTCCTCGCTCGGTGTCCTCAATTGGGCCCTGAATCACATCACCGGCGTCTGCACTAGC
GCTGCTGTTAACGGTTTCACTTGTCCTTACAGCAGAACCCACTTCAATACTTCCTTGATCTGGGGTGCAGTGGGT
CCTCGTCGTTACTTCTCAAACCAAATTGGCTATTCCGCTTTGCTTTATTTCTTCATCGTCGGTGCCATTCTACCC
ATTCCCGTCTATTATATGACCCGCCGATACCCCAAGTCACTATGGAGAAGGGTTCATATTCCCCTGTTCCTCGGT
GGGCTCAATTACTTGCCCCCTGCGACCGGAATGAATTACGGAAGCTGGGCAGTTGTCGGACTCACCTTTGGCTGG
CTCATTCGGAAGCGTCTGCATAGCTGGTGGAGTAAGTATAACTTTGTGCTGAGTTCTGCCATGGACTCGTCAGTG
GGAATTGCTGGTGTCTTGATTTTCTTGACAATTTTCTTTACTGGAGCCAGCAACCATTTCAAATGGTGGGGAACA
GAGGTTTACAAGGTGTGTTTACCCCCTCTGACGTTCAATTACCTATACTAACTATTAGCAGAACACCTGCGACTG
GAAAGGTTGTCCCGATCTTTCTGTACCAAAGGGCCATAAGTTCGGCGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail