Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6816.t1
Gene name
Locationscaffold_10:562744..565353
Strand+
Gene length (bp)2609
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 2.5E-13 752 796
PF12678 zf-rbx1 RING-H2 zinc finger domain 8.0E-10 766 796
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.0E-09 752 795
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.4E-07 753 795
PF17123 zf-RING_11 RING-like zinc finger 2.2E-07 753 781
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 6.2E-05 769 797

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0097602 cullin family protein binding Yes
GO:0046872 metal ion binding Yes
GO:0010498 proteasomal protein catabolic process No
GO:0008152 metabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0009987 cellular process No
GO:0019941 modification-dependent protein catabolic process No
GO:0005515 protein binding No
GO:0043169 cation binding No
GO:0009057 macromolecule catabolic process No
GO:0030163 protein catabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0032991 protein-containing complex No
GO:0019538 protein metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006508 proteolysis No
GO:0044265 cellular macromolecule catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0140096 catalytic activity, acting on a protein No
GO:1902494 catalytic complex No
GO:1901565 organonitrogen compound catabolic process No
GO:0046914 transition metal ion binding No
GO:0009056 catabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0043167 ion binding No
GO:0061659 ubiquitin-like protein ligase activity No
GO:1990234 transferase complex No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup6936
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g7632.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g2584.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g3158.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g7709.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g4522.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g7029.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g3460.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g3878.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g303.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g8836.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g5337.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g2733.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g5654.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g2835.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g2305.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g4700.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g1928.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g1494.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g6816.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g3161.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g8151.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g3567.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g5779.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g4314.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g5880.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g7264.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g5004.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g1395.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g5257.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g6211.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g3923.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g6644.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g3480.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g4605.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6816.t1
MGQSSSTQRDPSNNGYRVHFAPFSIQRGPNTRDENMNHRQAAEHNGEGGLPPRPDMNIHNRSDQDMASDRPGRTS
AGGSQPMRSIEEEGGPEYELPPREYRTAAFARMAARRQSTMSRLGSRLLPNSVIRGLLNSQEETPAEGHAHRHGL
VSPRAETAQTSGRFSAFDSFGSRGITRRRSARAPYFIPPRPESAGIPDAPATPTYIDSPSQIPDPTRASWRRSVR
LQRMRHSISSPISHMFGQPHSDLRPHESPEYPMSDPLFDDRAMDTRLDFGEPPHELESLEPSIQAERPVTDSSSA
QPSPALMRRLPGIIRARSSRVLRREEQTPLSRVLQLAASAIAAQLSGTAGPALPNIQALGNDGLDGSLENFIQSL
QHATSAQAQPPAADGSSSTANEGPSHPVNFLRVFRFANSEPSTSGAARQSASGVGDHGTQTDGMDIDEPAEGAGR
TVTLVVVGVRSVLAGNAGHTEQQQPVSPGPGLDALLGLPFLPHNTTIPRPQDATGEPTQRSDGRSRLTLPRNPTG
ATELPRPSVPNHFRRMSDTGPRAGFPSYHPSGFSESPPGPHPPPSTPAEQGISALSSGTSTPSRRPSSASAIAPD
ILPHLHEGQAMRPTAETLDEPVTFNTARQRRRSDSEYARHRALGSGAVRRNGMVEPDQPPPSGGRSWLIYVVGTN
LSENHPALTTPSLFTDNPTYEDMILLSSLLGPAKPPVASQTDINSAGGIFRLVEYAGSLVAEAVEGAASIQIQDG
ERCLICLSDYEVAEEVRELNKCKHVFHKDCIDQWLTTGRNSCPLCRGQGVNETPSNDSNTDNSVPSPAPAPAPAP
DGTAV*
Coding >Pro_DTO070G2_2|g6816.t1
ATGGGACAGTCCTCTTCTACACAACGTGATCCATCCAATAACGGCTATCGAGTACACTTTGCACCTTTCTCAATA
CAGCGTGGCCCTAACACGAGGGATGAAAACATGAATCATAGACAAGCGGCTGAACACAACGGAGAGGGTGGTTTG
CCACCCCGGCCAGACATGAACATACATAATAGGAGTGACCAAGATATGGCATCCGACCGGCCAGGCCGAACCTCC
GCTGGGGGCTCACAACCTATGCGAAGTATCGAAGAGGAGGGCGGGCCCGAATATGAGCTCCCACCCCGCGAATAC
CGCACTGCGGCGTTTGCTCGAATGGCAGCACGAAGACAATCGACCATGTCAAGACTGGGCTCTAGGCTTCTTCCA
AATTCAGTCATTCGTGGACTTCTCAACAGTCAAGAAGAGACCCCGGCCGAGGGACATGCACATCGACACGGCCTA
GTCTCTCCAAGAGCTGAGACTGCTCAAACATCCGGTCGGTTCAGTGCGTTCGATTCATTCGGCTCCAGAGGAATT
ACTCGGCGCCGATCTGCTCGCGCGCCATATTTCATTCCACCCCGTCCGGAGTCTGCTGGGATCCCAGATGCACCA
GCAACCCCGACATACATCGACTCTCCATCTCAAATACCTGACCCGACAAGAGCATCCTGGCGTCGCAGTGTCAGG
CTACAACGCATGCGTCATTCGATTTCATCTCCCATTTCTCACATGTTCGGCCAGCCACACTCAGATTTGCGGCCG
CACGAAAGCCCGGAATACCCAATGTCAGATCCTTTATTTGATGATAGGGCTATGGACACGCGTCTGGACTTCGGC
GAACCCCCCCATGAACTTGAATCACTAGAACCATCAATCCAGGCTGAGAGGCCGGTAACTGATTCGTCTTCTGCG
CAGCCGAGTCCTGCTTTGATGCGCCGATTGCCTGGGATCATCCGAGCAAGATCATCCAGAGTCCTGCGACGAGAG
GAGCAAACACCTCTGTCAAGGGTCCTTCAGCTCGCCGCATCCGCAATTGCAGCTCAGCTGTCCGGCACTGCCGGT
CCTGCGTTGCCTAACATCCAGGCATTGGGCAATGACGGGTTAGATGGCTCTTTGGAGAATTTCATCCAGAGTTTG
CAGCACGCGACTTCTGCGCAGGCTCAACCGCCTGCAGCAGACGGGTCGAGCAGTACTGCAAACGAAGGACCCTCG
CATCCCGTCAATTTCTTGCGTGTGTTCCGATTTGCCAATTCAGAACCATCCACAAGCGGCGCTGCAAGGCAGAGC
GCGAGTGGTGTCGGCGACCATGGGACCCAAACCGATGGAATGGACATCGACGAGCCTGCTGAAGGCGCAGGGCGA
ACGGTTACACTGGTTGTCGTTGGAGTTCGGTCCGTCCTGGCCGGAAACGCAGGTCATACCGAACAGCAACAGCCC
GTAAGTCCGGGCCCAGGTCTAGATGCTCTGCTTGGTCTGCCATTTTTGCCACATAATACTACTATCCCACGGCCT
CAAGATGCCACTGGTGAACCTACCCAACGGAGCGATGGGCGATCTAGATTGACTCTTCCTCGGAACCCCACCGGA
GCTACAGAACTTCCACGCCCGTCAGTTCCCAATCACTTTAGAAGAATGTCTGATACCGGCCCCCGTGCTGGATTC
CCATCCTATCATCCGTCTGGTTTCTCTGAAAGTCCCCCGGGACCACACCCGCCTCCGTCAACACCAGCTGAACAG
GGGATATCTGCTTTATCCTCCGGCACTTCGACTCCGAGCCGTAGACCATCCTCCGCTTCAGCAATTGCTCCTGAT
ATTCTGCCCCATCTACATGAAGGCCAGGCAATGCGACCGACGGCGGAGACTCTGGATGAGCCTGTGACATTCAAT
ACCGCTCGCCAGCGACGTCGAAGCGATTCTGAGTATGCTCGTCATCGGGCCCTCGGCTCTGGTGCTGTTCGACGC
AATGGCATGGTTGAACCCGATCAACCCCCACCAAGTGGAGGTCGCAGTTGGTTAATTTATGTTGTTGGAACCAAC
CTTTCTGAAAACCACCCGGCTTTGACCACACCTAGTCTTTTCACCGATAACCCAACCTACGAGGATATGATCCTA
CTTTCATCACTATTAGGTCCAGCTAAACCCCCTGTCGCCTCTCAGACCGATATCAACTCCGCCGGCGGAATATTC
CGTCTTGTCGAGTATGCAGGTTCATTGGTCGCCGAAGCCGTCGAAGGCGCTGCCTCCATTCAAATCCAAGATGGG
GAGCGCTGTTTGATATGCTTGAGTGATTATGAGGTGGCGGAAGAAGTTCGAGAGCTGAATAAATGCAAACATGTC
TTCCACAAGGATTGCATAGACCAGTGGTTAACCACTGGGAGAAACTCTTGTCCTCTCTGCCGAGGTCAAGGCGTC
AACGAAACCCCCAGCAACGACTCCAATACCGACAACTCGGTACCCAGTCCTGCCCCTGCTCCGGCTCCGGCTCCA
GATGGCACAGCTGTCTGA
Transcript >Pro_DTO070G2_2|g6816.t1
ATGGGACAGTCCTCTTCTACACAACGTGATCCATCCAATAACGGCTATCGAGTACACTTTGCACCTTTCTCAATA
CAGCGTGGCCCTAACACGAGGGATGAAAACATGAATCATAGACAAGCGGCTGAACACAACGGAGAGGGTGGTTTG
CCACCCCGGCCAGACATGAACATACATAATAGGAGTGACCAAGATATGGCATCCGACCGGCCAGGCCGAACCTCC
GCTGGGGGCTCACAACCTATGCGAAGTATCGAAGAGGAGGGCGGGCCCGAATATGAGCTCCCACCCCGCGAATAC
CGCACTGCGGCGTTTGCTCGAATGGCAGCACGAAGACAATCGACCATGTCAAGACTGGGCTCTAGGCTTCTTCCA
AATTCAGTCATTCGTGGACTTCTCAACAGTCAAGAAGAGACCCCGGCCGAGGGACATGCACATCGACACGGCCTA
GTCTCTCCAAGAGCTGAGACTGCTCAAACATCCGGTCGGTTCAGTGCGTTCGATTCATTCGGCTCCAGAGGAATT
ACTCGGCGCCGATCTGCTCGCGCGCCATATTTCATTCCACCCCGTCCGGAGTCTGCTGGGATCCCAGATGCACCA
GCAACCCCGACATACATCGACTCTCCATCTCAAATACCTGACCCGACAAGAGCATCCTGGCGTCGCAGTGTCAGG
CTACAACGCATGCGTCATTCGATTTCATCTCCCATTTCTCACATGTTCGGCCAGCCACACTCAGATTTGCGGCCG
CACGAAAGCCCGGAATACCCAATGTCAGATCCTTTATTTGATGATAGGGCTATGGACACGCGTCTGGACTTCGGC
GAACCCCCCCATGAACTTGAATCACTAGAACCATCAATCCAGGCTGAGAGGCCGGTAACTGATTCGTCTTCTGCG
CAGCCGAGTCCTGCTTTGATGCGCCGATTGCCTGGGATCATCCGAGCAAGATCATCCAGAGTCCTGCGACGAGAG
GAGCAAACACCTCTGTCAAGGGTCCTTCAGCTCGCCGCATCCGCAATTGCAGCTCAGCTGTCCGGCACTGCCGGT
CCTGCGTTGCCTAACATCCAGGCATTGGGCAATGACGGGTTAGATGGCTCTTTGGAGAATTTCATCCAGAGTTTG
CAGCACGCGACTTCTGCGCAGGCTCAACCGCCTGCAGCAGACGGGTCGAGCAGTACTGCAAACGAAGGACCCTCG
CATCCCGTCAATTTCTTGCGTGTGTTCCGATTTGCCAATTCAGAACCATCCACAAGCGGCGCTGCAAGGCAGAGC
GCGAGTGGTGTCGGCGACCATGGGACCCAAACCGATGGAATGGACATCGACGAGCCTGCTGAAGGCGCAGGGCGA
ACGGTTACACTGGTTGTCGTTGGAGTTCGGTCCGTCCTGGCCGGAAACGCAGGTCATACCGAACAGCAACAGCCC
GTAAGTCCGGGCCCAGGTCTAGATGCTCTGCTTGGTCTGCCATTTTTGCCACATAATACTACTATCCCACGGCCT
CAAGATGCCACTGGTGAACCTACCCAACGGAGCGATGGGCGATCTAGATTGACTCTTCCTCGGAACCCCACCGGA
GCTACAGAACTTCCACGCCCGTCAGTTCCCAATCACTTTAGAAGAATGTCTGATACCGGCCCCCGTGCTGGATTC
CCATCCTATCATCCGTCTGGTTTCTCTGAAAGTCCCCCGGGACCACACCCGCCTCCGTCAACACCAGCTGAACAG
GGGATATCTGCTTTATCCTCCGGCACTTCGACTCCGAGCCGTAGACCATCCTCCGCTTCAGCAATTGCTCCTGAT
ATTCTGCCCCATCTACATGAAGGCCAGGCAATGCGACCGACGGCGGAGACTCTGGATGAGCCTGTGACATTCAAT
ACCGCTCGCCAGCGACGTCGAAGCGATTCTGAGTATGCTCGTCATCGGGCCCTCGGCTCTGGTGCTGTTCGACGC
AATGGCATGGTTGAACCCGATCAACCCCCACCAAGTGGAGGTCGCAGTTGGTTAATTTATGTTGTTGGAACCAAC
CTTTCTGAAAACCACCCGGCTTTGACCACACCTAGTCTTTTCACCGATAACCCAACCTACGAGGATATGATCCTA
CTTTCATCACTATTAGGTCCAGCTAAACCCCCTGTCGCCTCTCAGACCGATATCAACTCCGCCGGCGGAATATTC
CGTCTTGTCGAGTATGCAGGTTCATTGGTCGCCGAAGCCGTCGAAGGCGCTGCCTCCATTCAAATCCAAGATGGG
GAGCGCTGTTTGATATGCTTGAGTGATTATGAGGTGGCGGAAGAAGTTCGAGAGCTGAATAAATGCAAACATGTC
TTCCACAAGGATTGCATAGACCAGTGGTTAACCACTGGGAGAAACTCTTGTCCTCTCTGCCGAGGTCAAGGCGTC
AACGAAACCCCCAGCAACGACTCCAATACCGACAACTCGGTACCCAGTCCTGCCCCTGCTCCGGCTCCGGCTCCA
GATGGCACAGCTGTCTGA
Gene >Pro_DTO070G2_2|g6816.t1
ATGGGACAGTCCTCTTCTACACAACGTGATCCATCCAATAACGGCTATCGAGTACACTTTGCACCTTTCTCAATA
CAGCGTGGCCCTAACACGAGGGATGAAAACATGAATCATAGACAAGCGGCTGAACACAACGGAGAGGGTGGTTTG
CCACCCCGGCCAGACATGAACATACATAATAGGAGTGACCAAGATATGGCATCCGACCGGCCAGGCCGAACCTCC
GCTGGGGGCTCACAACCTATGCGAAGTATCGAAGAGGAGGGCGGGCCCGAATATGAGCTCCCACCCCGCGAATAC
CGCACTGCGGCGTTTGCTCGAATGGCAGCACGAAGACAATCGACCATGTCAAGACTGGGCTCTAGGCTTCTTCCA
AATTCAGTCATTCGTGGACTTCTCAACAGTCAAGAAGAGACCCCGGCCGAGGGACATGCACATCGACACGGCCTA
GTCTCTCCAAGAGCTGAGACTGCTCAAACATCCGGTCGGTTCAGTGCGTTCGATTCATTCGGCTCCAGAGGAATT
ACTCGGCGCCGATCTGCTCGCGCGCCATATTTCATTCCACCCCGTCCGGAGTCTGCTGGGATCCCAGATGCACCA
GCAACCCCGACATACATCGACTCTCCATCTCAAATACCTGACCCGACAAGAGCATCCTGGCGTCGCAGTGTCAGG
CTACAACGCATGCGTCATTCGATTTCATCTCCCATTTCTCACATGTTCGGCCAGCCACACTCAGATTTGCGGCCG
CACGAAAGCCCGGAATACCCAATGTCAGATCCTTTATTTGATGATAGGGCTATGGACACGCGTCTGGACTTCGGC
GAACCCCCCCATGAACTTGAATCACTAGAACCATCAATCCAGGCTGAGAGGCCGGTAACTGATTCGTCTTCTGCG
CAGCCGAGTCCTGCTTTGATGCGCCGATTGCCTGGGATCATCCGAGCAAGATCATCCAGAGTCCTGCGACGAGAG
GAGCAAACACCTCTGTCAAGGGTCCTTCAGCTCGCCGCATCCGCAATTGCAGCTCAGCTGTCCGGCACTGCCGGT
CCTGCGTTGCCTAACATCCAGGCATTGGGCAATGACGGGTTAGATGGCTCTTTGGAGAATTTCATCCAGAGTTTG
CAGCACGCGACTTCTGCGCAGGCTCAACCGCCTGCAGCAGACGGGTCGAGCAGTACTGCAAACGAAGGACCCTCG
CATCCCGTCAATTTCTTGCGTGTGTTCCGATTTGCCAATTCAGAACCATCCACAAGCGGCGCTGCAAGGCAGAGC
GCGAGTGGTGTCGGCGACCATGGGACCCAAACCGATGGAATGGACATCGACGAGCCTGCTGAAGGCGCAGGGCGA
ACGGTTACACTGGTTGTCGTTGGAGTTCGGTCCGTCCTGGCCGGAAACGCAGGTCATACCGAACAGCAACAGCCC
GTAAGTCCGGGCCCAGGTCTAGATGCTCTGCTTGGTCTGCCATTTTTGCCACATAATACTACTATCCCACGGCCT
CAAGATGCCACTGGTGAACCTACCCAACGGAGCGATGGGCGATCTAGATTGACTCTTCCTCGGAACCCCACCGGA
GCTACAGAACTTCCACGCCCGTCAGTTCCCAATCACTTTAGAAGAATGTCTGATACCGGCCCCCGTGCTGGATTC
CCATCCTATCATCCGTCTGGTTTCTCTGAAAGTCCCCCGGGACCACACCCGCCTCCGTCAACACCAGCTGAACAG
GGGATATCTGCTTTATCCTCCGGCACTTCGACTCCGAGCCGTAGACCATCCTCCGCTTCAGCAATTGCTCCTGAT
ATTCTGCCCCATCTACATGAAGGCCAGGCAATGCGACCGACGGCGGAGACTCTGGATGAGCCTGTGACATTCAAT
ACCGCTCGCCAGCGACGTCGAAGCGATTCTGAGTATGCTCGTCATCGGGCCCTCGGCTCTGGTGCTGTTCGACGC
AATGGCATGGTTGAACCCGATCAACCCCCACCAAGTGGAGGTCGCAGTTGGTTAATTTATGTTGTTGGAACCAAC
CTTTCTGAAAACCACCCGGCTTTGACCACACCTAGTCTTTTCACCGATGTAAGAATGCCCTACTACTCGGTTTTG
TCAGGAACATGATGACTAATACTTTAAACAGAACCCAACCTACGAGGATATGATCCTACTTTCATCACTATTAGG
TCCAGCTAAACCCCCTGTCGCCTCTCAGACCGATATCAACTCCGCCGGCGGAATATTCCGTCTTGTCGAGTATGC
AGGTTCATTGGTCGCCGAAGCCGTCGAAGGCGCTGCCTCCATTCAAATCCAAGATGGGGAGCGCTGTTTGATATG
CTTGAGTGATTATGAGGTGGCGGAAGAAGTTCGAGAGCTGAATAAATGCAAACATGTCTTCCACAAGGATTGCAT
AGACCAGGTTTGTTGCCTCTGTCCATTCGATTTCAATCTGTTCGCTTGCTGACCGTATTTCGTAGTGGTTAACCA
CTGGGAGAAACTCTTGTCCTCTCTGCCGAGGTCAAGGCGTCAACGAAACCCCCAGCAACGACTCCAATACCGACA
ACTCGGTACCCAGTCCTGCCCCTGCTCCGGCTCCGGCTCCAGATGGCACAGCTGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail