Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g680.t1
Gene name
Locationscaffold_01:1788599..1791230
Strand-
Gene length (bp)2631
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 2.6E-24 286 403
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 9.4E-08 609 748

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 244 266 22
3 296 318 22
4 325 347 22
5 357 374 17
6 387 409 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g680.t1
MLLCWLVIALAQGGWANPEDERCVTAVYTAYNYISFAGILSQGKHSWESQCRNPLKVASIYAASDIYCNEQERTI
GMAQLANQCQEYGNLELLSREAVAENLTDDAIRNMRIVDYQELSRGEPVNAPVLLSASYFNLMFKTIESWELVTW
SHHAFGYIGYAYWGGILSLGMAYRLSDWLFHRRQRRVERVLESNVYPLMRSLDDMPLVGTGLHWIQTHLMIPPPL
AASHGRYLLGFTFSTRVEALIVVGFWTLSIVLSVVGYHTFPGNIYWPDVTSQVLRYSADRTGIMSFANLPLLWLF
AGRNNIFLWATGWSFASFNIFHRHVARVATIQAVVHSVLYIVMFHQTGKAARGMSKTYVLWGILGTFVMILLLIT
SLDRIRIATYELFLIAHVVLSILTLVACFYHTIIFEGNEYWKYLWPTVALWVVDRFLRIVRLCYCNLHVSLSNRL
VKVSESHMVYDETADVVRLEVILGTPSLQPSPGQYYFLYQPFRLTGWESHPFTVGAWSYEIGDQTSLAPKNEGKS
TRSLDVSHVPLLAGGPSDQDYPESSENMSKQEKLSKLNLTFWVRPYDGWTRHLRQQCLSSPAKTSKTTILLEGPY
GETFPLWRYESVLIIVGGTGIASAVPYIQDHLRRSVEDWDESPEMEKTRVRDMELVWTTKQAAFIRDVSRRELKR
ALKREDFSASFYATRDSTASSEDPTDFGFDIQSGRPHLQSLIMSRACDASSAGSSLAILVCGPPRMADEARAATH
LAMRQGHRSIKFVEESFTW*
Coding >Pro_DTO070G2_2|g680.t1
ATGTTGCTCTGTTGGCTGGTAATCGCACTCGCCCAAGGTGGCTGGGCTAATCCAGAGGATGAGCGGTGTGTGACG
GCGGTCTACACGGCATACAACTACATATCATTTGCTGGCATTCTCTCACAAGGCAAGCACAGCTGGGAATCGCAA
TGCCGGAATCCGCTCAAGGTCGCATCGATATACGCCGCATCCGATATATATTGCAATGAGCAGGAACGGACGATA
GGCATGGCGCAGCTGGCTAACCAGTGCCAAGAATATGGGAACCTAGAGCTGCTGTCGAGGGAAGCGGTCGCCGAA
AACCTGACAGACGATGCTATAAGGAATATGAGAATTGTCGACTATCAAGAGCTGTCCCGAGGCGAACCAGTGAAT
GCGCCTGTCCTTCTTTCTGCGTCTTACTTCAACCTAATGTTCAAAACGATTGAATCTTGGGAACTTGTGACTTGG
TCACATCATGCATTTGGTTATATTGGCTACGCCTATTGGGGTGGTATACTATCTTTGGGGATGGCCTATCGCTTG
AGTGATTGGCTATTCCATCGCCGACAACGCCGTGTAGAGCGTGTACTCGAATCCAATGTATATCCCCTCATGAGG
TCCTTGGACGATATGCCGTTGGTGGGCACCGGTCTTCACTGGATCCAGACTCATCTGATGATCCCACCGCCTTTG
GCAGCATCACATGGTCGATACCTGCTAGGCTTCACATTCTCCACCAGAGTCGAGGCGCTTATAGTCGTGGGATTC
TGGACGCTCAGCATCGTATTGAGTGTCGTGGGCTATCACACCTTTCCCGGAAATATTTACTGGCCCGATGTCACA
AGCCAGGTTCTTCGTTATTCTGCAGACCGCACTGGGATCATGTCATTTGCGAATTTGCCCCTTCTATGGCTCTTT
GCCGGACGAAATAATATTTTTCTTTGGGCCACCGGGTGGAGCTTTGCATCGTTCAATATATTCCATCGCCATGTG
GCCCGGGTGGCTACTATACAGGCAGTAGTGCACTCTGTCCTTTACATTGTCATGTTCCATCAAACGGGCAAAGCT
GCGAGGGGTATGTCGAAGACCTATGTTTTGTGGGGTATTTTGGGCACATTCGTGATGATTCTGCTGTTGATCACC
TCATTGGATCGGATCCGAATTGCGACATATGAGCTCTTCTTGATTGCTCATGTCGTACTTTCGATTCTCACCCTT
GTCGCGTGCTTTTACCATACCATTATATTTGAAGGAAACGAATACTGGAAGTACCTGTGGCCCACGGTAGCTTTA
TGGGTCGTTGATCGATTCCTTCGAATTGTGAGGTTGTGTTACTGTAACCTTCACGTGAGTCTCTCAAACAGACTT
GTGAAAGTTTCTGAGAGCCATATGGTTTACGACGAAACGGCCGACGTGGTGCGATTGGAGGTCATACTAGGAACG
CCTTCACTGCAGCCTTCACCAGGGCAGTACTACTTCCTATACCAGCCATTTAGGCTTACCGGCTGGGAGAGCCAT
CCTTTTACCGTTGGAGCATGGTCTTACGAAATAGGGGACCAGACATCATTGGCGCCAAAAAACGAGGGAAAATCA
ACTAGATCGCTTGATGTTTCGCATGTGCCGCTTCTTGCAGGCGGTCCCTCCGATCAAGATTATCCAGAAAGCTCA
GAAAACATGTCGAAGCAGGAGAAATTGTCGAAGTTGAACTTGACTTTCTGGGTCCGCCCGTATGACGGTTGGACC
AGACACTTGCGCCAGCAATGTCTGAGCTCACCAGCCAAGACTAGCAAAACGACCATTCTTCTTGAAGGCCCATAC
GGAGAAACCTTTCCCCTGTGGAGGTATGAATCAGTCTTGATTATCGTCGGTGGGACAGGAATAGCGTCGGCTGTG
CCTTATATTCAAGATCATCTCCGCCGGTCTGTTGAAGACTGGGACGAAAGCCCCGAAATGGAGAAGACACGAGTG
CGAGACATGGAGCTTGTTTGGACCACCAAACAAGCGGCGTTCATAAGAGATGTCTCTCGCCGGGAACTGAAACGT
GCCCTCAAACGAGAGGACTTCAGCGCCTCTTTTTATGCTACGCGTGATTCCACCGCATCCTCTGAAGATCCTACC
GATTTTGGATTCGATATCCAGTCAGGTCGACCCCACCTTCAATCCCTGATCATGAGCAGGGCCTGCGATGCATCC
TCGGCTGGAAGTAGCCTTGCGATCCTCGTATGTGGCCCACCCAGAATGGCGGATGAAGCGCGCGCCGCGACACAT
CTTGCGATGCGACAGGGCCACCGCTCGATCAAATTTGTGGAGGAGTCTTTTACGTGGTAG
Transcript >Pro_DTO070G2_2|g680.t1
ATGTTGCTCTGTTGGCTGGTAATCGCACTCGCCCAAGGTGGCTGGGCTAATCCAGAGGATGAGCGGTGTGTGACG
GCGGTCTACACGGCATACAACTACATATCATTTGCTGGCATTCTCTCACAAGGCAAGCACAGCTGGGAATCGCAA
TGCCGGAATCCGCTCAAGGTCGCATCGATATACGCCGCATCCGATATATATTGCAATGAGCAGGAACGGACGATA
GGCATGGCGCAGCTGGCTAACCAGTGCCAAGAATATGGGAACCTAGAGCTGCTGTCGAGGGAAGCGGTCGCCGAA
AACCTGACAGACGATGCTATAAGGAATATGAGAATTGTCGACTATCAAGAGCTGTCCCGAGGCGAACCAGTGAAT
GCGCCTGTCCTTCTTTCTGCGTCTTACTTCAACCTAATGTTCAAAACGATTGAATCTTGGGAACTTGTGACTTGG
TCACATCATGCATTTGGTTATATTGGCTACGCCTATTGGGGTGGTATACTATCTTTGGGGATGGCCTATCGCTTG
AGTGATTGGCTATTCCATCGCCGACAACGCCGTGTAGAGCGTGTACTCGAATCCAATGTATATCCCCTCATGAGG
TCCTTGGACGATATGCCGTTGGTGGGCACCGGTCTTCACTGGATCCAGACTCATCTGATGATCCCACCGCCTTTG
GCAGCATCACATGGTCGATACCTGCTAGGCTTCACATTCTCCACCAGAGTCGAGGCGCTTATAGTCGTGGGATTC
TGGACGCTCAGCATCGTATTGAGTGTCGTGGGCTATCACACCTTTCCCGGAAATATTTACTGGCCCGATGTCACA
AGCCAGGTTCTTCGTTATTCTGCAGACCGCACTGGGATCATGTCATTTGCGAATTTGCCCCTTCTATGGCTCTTT
GCCGGACGAAATAATATTTTTCTTTGGGCCACCGGGTGGAGCTTTGCATCGTTCAATATATTCCATCGCCATGTG
GCCCGGGTGGCTACTATACAGGCAGTAGTGCACTCTGTCCTTTACATTGTCATGTTCCATCAAACGGGCAAAGCT
GCGAGGGGTATGTCGAAGACCTATGTTTTGTGGGGTATTTTGGGCACATTCGTGATGATTCTGCTGTTGATCACC
TCATTGGATCGGATCCGAATTGCGACATATGAGCTCTTCTTGATTGCTCATGTCGTACTTTCGATTCTCACCCTT
GTCGCGTGCTTTTACCATACCATTATATTTGAAGGAAACGAATACTGGAAGTACCTGTGGCCCACGGTAGCTTTA
TGGGTCGTTGATCGATTCCTTCGAATTGTGAGGTTGTGTTACTGTAACCTTCACGTGAGTCTCTCAAACAGACTT
GTGAAAGTTTCTGAGAGCCATATGGTTTACGACGAAACGGCCGACGTGGTGCGATTGGAGGTCATACTAGGAACG
CCTTCACTGCAGCCTTCACCAGGGCAGTACTACTTCCTATACCAGCCATTTAGGCTTACCGGCTGGGAGAGCCAT
CCTTTTACCGTTGGAGCATGGTCTTACGAAATAGGGGACCAGACATCATTGGCGCCAAAAAACGAGGGAAAATCA
ACTAGATCGCTTGATGTTTCGCATGTGCCGCTTCTTGCAGGCGGTCCCTCCGATCAAGATTATCCAGAAAGCTCA
GAAAACATGTCGAAGCAGGAGAAATTGTCGAAGTTGAACTTGACTTTCTGGGTCCGCCCGTATGACGGTTGGACC
AGACACTTGCGCCAGCAATGTCTGAGCTCACCAGCCAAGACTAGCAAAACGACCATTCTTCTTGAAGGCCCATAC
GGAGAAACCTTTCCCCTGTGGAGGTATGAATCAGTCTTGATTATCGTCGGTGGGACAGGAATAGCGTCGGCTGTG
CCTTATATTCAAGATCATCTCCGCCGGTCTGTTGAAGACTGGGACGAAAGCCCCGAAATGGAGAAGACACGAGTG
CGAGACATGGAGCTTGTTTGGACCACCAAACAAGCGGCGTTCATAAGAGATGTCTCTCGCCGGGAACTGAAACGT
GCCCTCAAACGAGAGGACTTCAGCGCCTCTTTTTATGCTACGCGTGATTCCACCGCATCCTCTGAAGATCCTACC
GATTTTGGATTCGATATCCAGTCAGGTCGACCCCACCTTCAATCCCTGATCATGAGCAGGGCCTGCGATGCATCC
TCGGCTGGAAGTAGCCTTGCGATCCTCGTATGTGGCCCACCCAGAATGGCGGATGAAGCGCGCGCCGCGACACAT
CTTGCGATGCGACAGGGCCACCGCTCGATCAAATTTGTGGAGGAGTCTTTTACGTGGTAG
Gene >Pro_DTO070G2_2|g680.t1
ATGTTGCTCTGTTGGCTGGTAATCGCACTCGCCCAAGGTGGCTGGGCTAATCCAGAGGATGAGCGGTGTGTGACG
GCGGTCTACACGGCATACAACTACATATCATTTGCTGGCATTCTCTCACAAGGCAAGCACAGCTGGGAATCGCAA
TGCCGGAATCCGCTCAAGGTCGCATCGATATACGCCGCATCCGATATATATTGCAATGAGCAGGAACGGACGATA
GGCATGGCGCAGCTGGCTAACCAGTGCCAAGAATATGGGAACCTAGAGCTGCTGTCGAGGGAAGCGGTCGCCGAA
AACCTGACAGACGATGCTATAAGGAATATGAGAATTGTCGACTATCAAGAGCTGTCCCGAGGCGAACCAGTGAAT
GCGCCTGTCCTTCTTTCTGCGTCTTACTTCAACCTAATGTTCAAAACGATTGTGAGACCTTCTGGACCTTGAATA
TGCTAGTCCTAAAGCTTATTGATGTCCTAGGAATCTTGGGAACTTGTGACTTGGTCACATCATGCATTTGGGTAA
GTCTGCTCAAGCTGGCAAGCAAGACATATATTGACTAATCAGTTATATTGGCTACGCCTATTGGGGTGGTATACT
ATCTTTGGGGATGGCCTATCGCTTGAGTGATTGGCTATTCCATCGCCGACAACGCCGTGTAGAGCGTGTACTCGA
ATCCAATGTATATCCCCTCATGAGGTCCTTGGACGATATGCCGTTGGTGGGCACCGGTCTTCACTGGATCCAGAC
TCATCTGATGATCCCACCGCCTTTGGCAGCATCACATGGTCGATACCTGCTAGGCTTCACATTCTCCACCAGAGT
CGAGGCGCTTATAGTCGTGGGATTCTGGACGCTCAGCATCGTATTGAGTGTCGTGGGCTATCACACCTTTCCCGG
AAATATTTAGTAGGTACCAGCCTGTGGAAGCGAGATGTGCAATGTTGACAGGTAGTCTAGCTGGCCCGATGTCAC
AAGCCAGGTTCTTCGTTATTCTGCAGACCGCACTGGGATCATGTCATTTGCGAATTTGCCCCTTCTATGGCTCTT
TGCCGGACGAAATAATATTTTTCTTTGGGCCACCGGGTGGAGCTTTGCATCGTTCAATATATTCCATCGCCATGT
GGCCCGGGTGGCTACTATACAGGCAGTAGTGCACTCTGTCCTTTACATTGTCATGTTCCATCAAAGTAAGTATTG
CTCGTTTGGCTTTCAATGCGCGCTAGGATACTTACAGTCATTCCGACAGCGGGCAAAGCTGCGAGGGGTATGTCG
AAGACCTATGTTTTGTGGGGTATTTTGGTAGGCCCCCCAATTTAATTGATCCCAAGTTGGTCGATCTCTAATTCA
TGTTGTATTAGGGCACATTCGTGATGATTCTGCTGTTGATCACCTCATTGGATCGGATCCGAATTGCGACATATG
AGCTCTTCTTGATTGCTCATGTCGTACTTTCGATTCTCACCCTTGTCGCGTGCTTTTAGTAAGTACATCCCCGCG
ATGAAATTTCTGCATCTATTTCTAACAATTGGCAGCCATACCATTATATTTGAAGGAAACGAATACTGGAAGTAC
CTGTGGCCCACGGTAGCTTTATGGGTCGTTGATCGATTCCTTCGAATTGTGAGGTTGTGTTACTGTAACCTTCAC
GTGAGTCTCTCAAACAGACTTGTGAAAGTTTCTGAGAGCCATATGGTTTACGACGAAACGGCCGACGTGGTGCGA
TTGGAGGTCATACTAGGAACGCCTTCACTGCAGCCTTCACCAGGGCAGTACTACTTCCTATACCAGCCATTTAGG
CTTACCGGCTGGGAGAGCCATCCTTTTACCGTTGGAGCATGGTCTTACGAAATAGGGGACCAGACATCATTGGCG
CCAAAAAACGAGGGAAAATCAACTAGATCGCTTGATGTTTCGCATGTGCCGCTTCTTGCAGGCGGTCCCTCCGAT
CAAGATTATCCAGAAAGCTCAGAAAACATGTCGAAGCAGGAGAAATTGTCGAAGTTGAACTTGACTTTCTGGGTC
CGCCCGTATGACGGTTGGACCAGACACTTGCGCCAGCAATGTCTGAGCTCACCAGCCAAGACTAGCAAAACGACC
ATTCTTCTTGAAGGCCCATACGGAGAAACCTTTCCCCTGTGGAGGTATGAATCAGTCTTGATTATCGTCGGTGGG
ACAGGAATAGCGTCGGCTGTGCCTTATATTCAAGATCATCTCCGCCGGTCTGTTGAAGACTGGGACGAAAGCCCC
GAAATGGAGAAGACACGAGTGCGAGACATGGAGCTTGTTTGGACCACCAAACAAGCGGCGTTCATAAGAGATGTC
TCTCGCCGGGAACTGAAACGTGCCCTCAAACGAGAGGACTTCAGCGCCTCTTTTTATGCTACGCGTGATTCCACC
GCATCCTCTGAAGATCCTACCGATTTTGGATTCGATATCCAGTCAGGTCGACCCCACCTTCAATCCCTGATCATG
AGCAGGGCCTGCGATGCATCCTCGGCTGGAAGTAGCCTTGCGATCCTCGTATGTGGCCCACCCAGAATGGCGGAT
GAAGCGCGCGCCGCGACACATCTTGCGATGCGACAGGGCCACCGCTCGATCAAATTTGTGGAGGAGTCTTTTACG
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail