Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6703.t1
Gene name
Locationscaffold_10:294315..297785
Strand-
Gene length (bp)3470
Transcript length (bp)3417
Coding sequence length (bp)3417
Protein length (aa) 1139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.1E-40 711 999
PF06479 Ribonuc_2-5A Ribonuclease 2-5A 1.4E-40 1005 1134
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 5.2E-20 711 993

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004540 ribonuclease activity Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0006397 mRNA processing Yes
GO:0036211 protein modification process No
GO:0016301 kinase activity No
GO:0008152 metabolic process No
GO:0032553 ribonucleotide binding No
GO:0006396 RNA processing No
GO:0043168 anion binding No
GO:0016740 transferase activity No
GO:0017076 purine nucleotide binding No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004518 nuclease activity No
GO:0097367 carbohydrate derivative binding No
GO:0046483 heterocycle metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032559 adenyl ribonucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016071 mRNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0016310 phosphorylation No
GO:0036094 small molecule binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6703.t1
MRWRLPGVRSTLPASVALLLLPALVAPLQQSDAHDPISRVSVPLAQESSRQNAAHVAAPPIVKPNDASALATLAL
AGSGRAVRAPPVQASSTAAGLASQLHARSLQDWEVEDFVLLATVDGTIHARDRKTGTARWALEVPSSPVVESIYH
RANRSSFDDTEPEDDFLWIVEPSQDGSLYIYSPAPDAGLQKLGLTVKQLVDETPYSGTDPAVTYTARKETTLYTI
DARTGSILRVFSSRGPITAAPECRKVDGEDLESDECESTSGTLVLGRVEYAVAIQNTETGDPICTLKYSEWAPNN
RDMDLQSQYYRTMDESHIYSMHDGVVLGFDHSRMGRPRYTQRFSSPVARVFDVVRPANKDTPDASTPLVLLSQPS
QPPDPDYGSLNEERDMRVYIDCTEAGGWYAFSEETYPLATGRAPMAQCYDKDFFRRGQALMSLSARQQRNALAGV
HSLTGPRIIRPNIPRIAGSSTSELSNDTPRDILRSPSELALPPALRNSAIIRKSWDNALDIVVTLILLFICTFIY
FNSHHIRDLAKQKLDIKNIINSNDKPSLSTPSTPLVGGAPDIKRSSTPTQEVPNVTVDLDLEDASPEGALTPRAS
REYNPDSTLRVQIREPSRGPGDEDADEPGKPKKKTRYRGSRGGKAHRRRKKPGSEGDGPEGADQAAEQVNTLAPQ
PRLETDAQMTRTISNEIIEMDGVVRIGRLRVFTDVVLGHGSHGTVVYRGSFDGRDVAVKRMLMEFYDIASHEVGL
LQESDDHHNVIRYFCREQATGFLYIGLELCPASLQDVIERPASYPELVQAGLDLPDVLRQITQGVRYLHSLKIVH
RDLKPQNILVAMPRGRTVSRSLRLLISDFGLCKKLEDNQSSFRATTAHAAGTSGWRAPELLVDDDGPISLASQHT
ESSEPAVVDPQTNRRATRAIDIFSLGCVFYYVLTRGSHPFDKNGKFMREANIVKGQFDLEELSRLGDYAFEADDL
IRSMLSLDPRQRPDASAVLMHPFFWPPSDRLAFLCDVSDHFEFEPREPPSDALLCLESVAKRVMGPDMDFLRSLP
RDFKDNLGKQRKYTGGRMLDLLRALRNKRNHYNDMPDHLKDNIGGLPEGYLNFWTYRFPSLLMSCHSVIVELDLA
HNDRFRRYFVPPE*
Coding >Pro_DTO070G2_2|g6703.t1
ATGCGGTGGCGGCTGCCGGGCGTCCGTTCGACACTCCCCGCCAGTGTCGCACTCCTTCTTCTCCCAGCTCTGGTC
GCTCCGCTGCAGCAATCAGATGCCCATGACCCTATATCTCGCGTCTCTGTGCCACTAGCACAAGAGTCATCTAGA
CAAAATGCGGCCCATGTAGCCGCACCACCCATCGTGAAACCCAACGATGCGAGCGCCCTTGCTACTCTGGCTCTG
GCAGGCTCCGGCCGCGCCGTTCGAGCCCCTCCTGTCCAAGCCAGCAGCACTGCTGCTGGTTTGGCTTCGCAGCTT
CACGCGCGGTCCTTGCAGGACTGGGAGGTTGAGGATTTTGTGCTGCTGGCGACCGTCGACGGAACCATTCACGCC
CGTGATCGTAAGACCGGGACTGCTCGCTGGGCCCTCGAGGTCCCGAGCAGTCCTGTGGTCGAAAGCATCTACCAC
CGAGCGAATCGTTCCAGTTTTGACGATACAGAACCGGAAGACGACTTTTTGTGGATCGTCGAGCCGAGCCAGGAT
GGCAGCCTATATATCTACAGCCCCGCCCCAGATGCCGGCTTGCAAAAGCTCGGCTTAACAGTGAAGCAGCTTGTT
GACGAAACCCCTTATTCCGGCACCGACCCCGCCGTGACCTATACTGCCCGGAAGGAAACTACATTGTATACGATT
GACGCCCGGACTGGCAGCATCCTGCGGGTGTTTAGTTCCCGTGGTCCAATTACCGCTGCACCTGAATGTCGGAAG
GTGGACGGAGAAGATTTGGAATCTGATGAATGCGAGTCGACATCTGGCACTTTGGTTCTTGGTCGGGTTGAATAT
GCCGTTGCCATACAAAACACGGAGACGGGAGATCCAATTTGTACCTTGAAGTACTCCGAGTGGGCACCAAACAAT
CGTGATATGGACCTACAAAGCCAGTACTACAGGACGATGGATGAAAGTCACATTTACAGTATGCATGATGGCGTT
GTACTGGGATTCGATCACTCGCGCATGGGTCGGCCTCGCTATACCCAGCGCTTTTCATCTCCTGTGGCGCGAGTC
TTTGACGTGGTTCGTCCTGCCAACAAAGATACACCAGATGCCTCGACCCCGCTAGTCCTGCTCTCACAACCCAGC
CAGCCACCGGATCCAGATTATGGATCCCTTAACGAGGAAAGGGACATGCGTGTATACATCGATTGCACTGAGGCG
GGGGGCTGGTATGCCTTTTCGGAGGAAACCTATCCCCTAGCCACGGGCCGGGCTCCAATGGCTCAATGCTATGAC
AAAGACTTCTTCCGCCGGGGGCAAGCGCTTATGAGTCTGAGTGCGCGTCAGCAGCGGAATGCGTTGGCCGGTGTT
CACTCTCTCACTGGCCCTCGTATAATCCGGCCAAATATTCCTAGAATCGCCGGATCGTCCACCTCTGAACTTTCC
AATGACACACCACGAGATATCCTTCGCAGCCCTTCTGAGCTGGCTTTGCCTCCCGCCTTGCGCAATAGCGCCATC
ATTCGCAAGAGCTGGGACAATGCTTTGGATATTGTCGTGACGTTGATTTTACTGTTCATCTGCACCTTCATTTAC
TTCAACTCGCATCACATTCGCGATTTGGCAAAGCAGAAGTTGGACATCAAGAATATCATCAACTCGAATGATAAG
CCTTCTCTCTCGACCCCTTCCACACCTCTTGTCGGCGGTGCCCCGGATATCAAGCGTTCATCTACACCAACCCAG
GAAGTTCCAAACGTCACAGTGGACTTAGATTTAGAGGATGCATCACCGGAGGGCGCATTAACCCCCCGTGCTTCC
CGAGAATACAATCCAGATTCCACCCTCCGGGTGCAGATTCGCGAGCCGTCACGTGGGCCTGGTGACGAGGATGCC
GATGAGCCTGGAAAGCCAAAGAAAAAAACCCGCTATCGTGGATCTCGAGGAGGAAAGGCACACCGCCGTCGCAAG
AAGCCTGGCAGTGAGGGTGATGGCCCCGAAGGAGCCGATCAGGCCGCCGAACAAGTCAACACCCTAGCCCCCCAG
CCTCGACTTGAAACCGATGCACAGATGACCAGGACGATCTCGAACGAGATTATAGAGATGGATGGCGTGGTTCGC
ATAGGCCGGCTTCGGGTTTTCACTGATGTTGTGCTTGGACATGGCAGCCATGGCACTGTGGTTTACCGCGGTTCG
TTCGACGGACGAGACGTCGCGGTCAAGCGTATGTTGATGGAATTCTATGACATTGCGTCCCATGAAGTGGGCCTA
TTGCAGGAAAGCGATGACCACCACAACGTGATCCGATACTTCTGCCGTGAACAAGCCACCGGGTTCCTGTATATT
GGCCTCGAGCTTTGTCCAGCGTCTCTTCAGGATGTGATTGAGCGTCCTGCTAGCTACCCGGAACTAGTTCAAGCC
GGCTTAGATCTGCCAGACGTACTGCGGCAGATTACACAGGGTGTCCGTTACTTGCACTCTTTGAAGATCGTCCAC
CGTGATTTGAAGCCGCAGAACATCCTCGTGGCTATGCCCCGTGGCCGCACTGTTTCGCGGTCATTGCGTCTCCTC
ATCTCGGATTTTGGCTTGTGCAAGAAACTCGAAGACAACCAAAGCTCGTTCCGGGCAACCACTGCTCACGCCGCT
GGAACTTCCGGCTGGCGTGCCCCCGAGCTCCTGGTGGATGATGACGGCCCTATATCTCTTGCATCCCAGCATACC
GAGTCTTCGGAGCCGGCTGTGGTGGACCCGCAGACCAACCGCCGCGCCACTCGGGCCATTGACATTTTCTCGCTG
GGTTGTGTGTTCTACTACGTCTTGACTCGTGGCAGCCACCCATTCGACAAAAATGGCAAGTTCATGCGTGAAGCA
AACATCGTCAAGGGCCAATTCGATTTGGAAGAATTAAGCCGCCTAGGCGACTACGCTTTCGAGGCGGATGATCTG
ATCCGCTCAATGCTGTCTCTAGACCCTCGGCAACGTCCTGATGCAAGCGCTGTATTAATGCACCCGTTCTTCTGG
CCCCCATCAGACCGTCTCGCCTTCCTTTGTGATGTATCTGACCACTTCGAATTTGAGCCCCGCGAGCCTCCATCA
GACGCACTGCTTTGTTTGGAATCAGTGGCCAAGCGAGTAATGGGTCCCGACATGGATTTCCTGCGCTCATTGCCG
CGGGATTTCAAAGACAATCTCGGCAAGCAGCGCAAATATACCGGGGGGCGGATGCTGGATCTCCTGAGGGCTCTC
CGCAACAAGCGCAATCACTACAACGATATGCCTGATCATCTTAAGGATAATATTGGTGGCTTGCCTGAAGGATAT
CTCAATTTCTGGACATACAGGTTCCCAAGTCTGTTGATGAGCTGTCATTCGGTCATTGTTGAGCTGGATTTAGCT
CACAATGATCGCTTCCGGAGGTATTTTGTGCCTCCGGAATAG
Transcript >Pro_DTO070G2_2|g6703.t1
ATGCGGTGGCGGCTGCCGGGCGTCCGTTCGACACTCCCCGCCAGTGTCGCACTCCTTCTTCTCCCAGCTCTGGTC
GCTCCGCTGCAGCAATCAGATGCCCATGACCCTATATCTCGCGTCTCTGTGCCACTAGCACAAGAGTCATCTAGA
CAAAATGCGGCCCATGTAGCCGCACCACCCATCGTGAAACCCAACGATGCGAGCGCCCTTGCTACTCTGGCTCTG
GCAGGCTCCGGCCGCGCCGTTCGAGCCCCTCCTGTCCAAGCCAGCAGCACTGCTGCTGGTTTGGCTTCGCAGCTT
CACGCGCGGTCCTTGCAGGACTGGGAGGTTGAGGATTTTGTGCTGCTGGCGACCGTCGACGGAACCATTCACGCC
CGTGATCGTAAGACCGGGACTGCTCGCTGGGCCCTCGAGGTCCCGAGCAGTCCTGTGGTCGAAAGCATCTACCAC
CGAGCGAATCGTTCCAGTTTTGACGATACAGAACCGGAAGACGACTTTTTGTGGATCGTCGAGCCGAGCCAGGAT
GGCAGCCTATATATCTACAGCCCCGCCCCAGATGCCGGCTTGCAAAAGCTCGGCTTAACAGTGAAGCAGCTTGTT
GACGAAACCCCTTATTCCGGCACCGACCCCGCCGTGACCTATACTGCCCGGAAGGAAACTACATTGTATACGATT
GACGCCCGGACTGGCAGCATCCTGCGGGTGTTTAGTTCCCGTGGTCCAATTACCGCTGCACCTGAATGTCGGAAG
GTGGACGGAGAAGATTTGGAATCTGATGAATGCGAGTCGACATCTGGCACTTTGGTTCTTGGTCGGGTTGAATAT
GCCGTTGCCATACAAAACACGGAGACGGGAGATCCAATTTGTACCTTGAAGTACTCCGAGTGGGCACCAAACAAT
CGTGATATGGACCTACAAAGCCAGTACTACAGGACGATGGATGAAAGTCACATTTACAGTATGCATGATGGCGTT
GTACTGGGATTCGATCACTCGCGCATGGGTCGGCCTCGCTATACCCAGCGCTTTTCATCTCCTGTGGCGCGAGTC
TTTGACGTGGTTCGTCCTGCCAACAAAGATACACCAGATGCCTCGACCCCGCTAGTCCTGCTCTCACAACCCAGC
CAGCCACCGGATCCAGATTATGGATCCCTTAACGAGGAAAGGGACATGCGTGTATACATCGATTGCACTGAGGCG
GGGGGCTGGTATGCCTTTTCGGAGGAAACCTATCCCCTAGCCACGGGCCGGGCTCCAATGGCTCAATGCTATGAC
AAAGACTTCTTCCGCCGGGGGCAAGCGCTTATGAGTCTGAGTGCGCGTCAGCAGCGGAATGCGTTGGCCGGTGTT
CACTCTCTCACTGGCCCTCGTATAATCCGGCCAAATATTCCTAGAATCGCCGGATCGTCCACCTCTGAACTTTCC
AATGACACACCACGAGATATCCTTCGCAGCCCTTCTGAGCTGGCTTTGCCTCCCGCCTTGCGCAATAGCGCCATC
ATTCGCAAGAGCTGGGACAATGCTTTGGATATTGTCGTGACGTTGATTTTACTGTTCATCTGCACCTTCATTTAC
TTCAACTCGCATCACATTCGCGATTTGGCAAAGCAGAAGTTGGACATCAAGAATATCATCAACTCGAATGATAAG
CCTTCTCTCTCGACCCCTTCCACACCTCTTGTCGGCGGTGCCCCGGATATCAAGCGTTCATCTACACCAACCCAG
GAAGTTCCAAACGTCACAGTGGACTTAGATTTAGAGGATGCATCACCGGAGGGCGCATTAACCCCCCGTGCTTCC
CGAGAATACAATCCAGATTCCACCCTCCGGGTGCAGATTCGCGAGCCGTCACGTGGGCCTGGTGACGAGGATGCC
GATGAGCCTGGAAAGCCAAAGAAAAAAACCCGCTATCGTGGATCTCGAGGAGGAAAGGCACACCGCCGTCGCAAG
AAGCCTGGCAGTGAGGGTGATGGCCCCGAAGGAGCCGATCAGGCCGCCGAACAAGTCAACACCCTAGCCCCCCAG
CCTCGACTTGAAACCGATGCACAGATGACCAGGACGATCTCGAACGAGATTATAGAGATGGATGGCGTGGTTCGC
ATAGGCCGGCTTCGGGTTTTCACTGATGTTGTGCTTGGACATGGCAGCCATGGCACTGTGGTTTACCGCGGTTCG
TTCGACGGACGAGACGTCGCGGTCAAGCGTATGTTGATGGAATTCTATGACATTGCGTCCCATGAAGTGGGCCTA
TTGCAGGAAAGCGATGACCACCACAACGTGATCCGATACTTCTGCCGTGAACAAGCCACCGGGTTCCTGTATATT
GGCCTCGAGCTTTGTCCAGCGTCTCTTCAGGATGTGATTGAGCGTCCTGCTAGCTACCCGGAACTAGTTCAAGCC
GGCTTAGATCTGCCAGACGTACTGCGGCAGATTACACAGGGTGTCCGTTACTTGCACTCTTTGAAGATCGTCCAC
CGTGATTTGAAGCCGCAGAACATCCTCGTGGCTATGCCCCGTGGCCGCACTGTTTCGCGGTCATTGCGTCTCCTC
ATCTCGGATTTTGGCTTGTGCAAGAAACTCGAAGACAACCAAAGCTCGTTCCGGGCAACCACTGCTCACGCCGCT
GGAACTTCCGGCTGGCGTGCCCCCGAGCTCCTGGTGGATGATGACGGCCCTATATCTCTTGCATCCCAGCATACC
GAGTCTTCGGAGCCGGCTGTGGTGGACCCGCAGACCAACCGCCGCGCCACTCGGGCCATTGACATTTTCTCGCTG
GGTTGTGTGTTCTACTACGTCTTGACTCGTGGCAGCCACCCATTCGACAAAAATGGCAAGTTCATGCGTGAAGCA
AACATCGTCAAGGGCCAATTCGATTTGGAAGAATTAAGCCGCCTAGGCGACTACGCTTTCGAGGCGGATGATCTG
ATCCGCTCAATGCTGTCTCTAGACCCTCGGCAACGTCCTGATGCAAGCGCTGTATTAATGCACCCGTTCTTCTGG
CCCCCATCAGACCGTCTCGCCTTCCTTTGTGATGTATCTGACCACTTCGAATTTGAGCCCCGCGAGCCTCCATCA
GACGCACTGCTTTGTTTGGAATCAGTGGCCAAGCGAGTAATGGGTCCCGACATGGATTTCCTGCGCTCATTGCCG
CGGGATTTCAAAGACAATCTCGGCAAGCAGCGCAAATATACCGGGGGGCGGATGCTGGATCTCCTGAGGGCTCTC
CGCAACAAGCGCAATCACTACAACGATATGCCTGATCATCTTAAGGATAATATTGGTGGCTTGCCTGAAGGATAT
CTCAATTTCTGGACATACAGGTTCCCAAGTCTGTTGATGAGCTGTCATTCGGTCATTGTTGAGCTGGATTTAGCT
CACAATGATCGCTTCCGGAGGTATTTTGTGCCTCCGGAATAG
Gene >Pro_DTO070G2_2|g6703.t1
ATGCGGTGGCGGCTGCCGGGCGTCCGTTCGACACTCCCCGCCAGTGTCGCACTCCTTCTTCTCCCAGCTCTGGTC
GCTCCGCTGCAGCAATCAGATGCCCATGACCCTATATCTCGCGTCTCTGTGCCACTAGCACAAGAGTCATCTAGA
CAAAATGCGGCCCATGTAGCCGCACCACCCATCGTGAAACCCAACGATGCGAGCGCCCTTGCTACTCTGGCTCTG
GCAGGCTCCGGCCGCGCCGTTCGAGCCCCTCCTGTCCAAGCCAGCAGCACTGCTGCTGGTTTGGCTTCGCAGCTT
CACGCGCGGTCCTTGCAGGACTGGGAGGTTGAGGATTTTGTGCTGCTGGCGACCGTCGACGGAACCATTCACGCC
CGTGATCGTAAGACCGGGACTGCTCGCTGGGCCCTCGAGGTCCCGAGCAGTCCTGTGGTCGAAAGCATCTACCAC
CGAGCGAATCGTTCCAGTTTTGACGATACAGAACCGGAAGACGACTTTTTGTGGATCGTCGAGCCGAGCCAGGAT
GGCAGCCTATATATCTACAGCCCCGCCCCAGATGCCGGCTTGCAAAAGCTCGGCTTAACAGTGAAGCAGCTTGTT
GACGAAACCCCTTATTCCGGCACCGACCCCGCCGTGACCTATACTGCCCGGAAGGAAACTACATTGTATACGATT
GACGCCCGGACTGGCAGCATCCTGCGGGTGTTTAGTTCCCGTGGTCCAATTACCGCTGCACCTGAATGTCGGAAG
GTGGACGGAGAAGATTTGGAATCTGATGAATGCGAGTCGACATCTGGCACTTTGGTTCTTGGTCGGGTTGAATAT
GCCGTTGCCATACAAAACACGGAGACGGGAGATCCAATTTGTACCTTGAAGTACTCCGAGTGGGCACCAAACAAT
CGTGATATGGACCTACAAAGCCAGTACTACAGGACGATGGATGAAAGTCACATTTACAGTATGCATGATGGCGTT
GTACTGGGATTCGATCACTCGCGCATGGGTCGGCCTCGCTATACCCAGCGCTTTTCATCTCCTGTGGCGCGAGTC
TTTGACGTGGTTCGTCCTGCCAACAAAGATACACCAGATGCCTCGACCCCGCTAGTCCTGCTCTCACAACCCAGC
CAGCCACCGGATCCAGATTATGGATCCCTTAACGAGGAAAGGGACATGCGTGTATACATCGATTGCACTGAGGCG
GGGGGCTGGTATGCCTTTTCGGAGGAAACCTATCCCCTAGCCACGGGCCGGGCTCCAATGGCTCAATGCTATGAC
AAAGACTTCTTCCGCCGGGGGCAAGCGCTTATGAGTCTGAGTGCGCGTCAGCAGCGGAATGCGTTGGCCGGTGTT
CACTCTCTCACTGGCCCTCGTATAATCCGGCCAAATATTCCTAGAATCGCCGGATCGTCCACCTCTGAACTTTCC
AATGACACACCACGAGATATCCTTCGCAGCCCTTCTGAGCTGGCTTTGCCTCCCGCCTTGCGCAATAGCGCCATC
ATTCGCAAGAGCTGGGACAATGCTTTGGATATTGTCGTGACGTTGATTTTACTGTTCATCTGCACCTTCATTTAC
TTCAACTCGCATCACATTCGCGATTTGGCAAAGCAGAAGTTGGACATCAAGAATATCATCAACTCGAATGATAAG
CCTTCTCTCTCGACCCCTTCCACACCTCTTGTCGGCGGTGCCCCGGATATCAAGCGTTCATCTACACCAACCCAG
GAAGTTCCAAACGTCACAGTGGACTTAGATTTAGAGGATGCATCACCGGAGGGCGCATTAACCCCCCGTGCTTCC
CGAGAATACAATCCAGATTCCACCCTCCGGGTGCAGATTCGCGAGCCGTCACGTGGGCCTGGTGACGAGGATGCC
GATGAGCCTGGAAAGCCAAAGAAAAAAACCCGCTATCGTGGATCTCGAGGAGGAAAGGCACACCGCCGTCGCAAG
AAGCCTGGCAGTGAGGGTGATGGCCCCGAAGGAGCCGATCAGGCCGCCGAACAAGTCAACACCCTAGCCCCCCAG
CCTCGACTTGAAACCGATGCACAGATGACCAGGACGATCTCGAACGAGATTATAGAGATGGATGGCGTGGTTCGC
ATAGGCCGGCTTCGGGTTTTCACTGATGTTGTGCTTGGACATGGCAGCCATGGCACTGTGGTTTACCGCGGTTCG
TTCGACGGACGAGACGTCGCGGTCAAGCGTATGTTGATGGAATTCTATGACATTGCGTCCCATGAAGTGGGCCTA
TTGCAGGAAAGCGATGACCACCACAACGTGATCCGATACTTCTGCCGTGAACAAGCCACCGGGTTCCTGTATATT
GGCCTCGAGCTTTGTCCAGCGTCTCTTCAGGATGTGATTGAGCGTCCTGCTAGCTACCCGGAACTAGTTCAAGCC
GGCTTAGATCTGCCAGACGTACTGCGGCAGATTACACAGGGTGTCCGTTACTTGCACTCTTTGAAGATCGTCCAC
CGTGATTTGAAGCCGCAGAACATCCTCGTGGCTATGCCCCGTGGCCGCACTGTTTCGCGGTCATTGCGTCTCCTC
ATCTCGGATTTTGGCTTGTGCAAGAAACTCGAAGACAACCAAAGCTCGTTCCGGGCAACCACTGCTCACGCCGCT
GGAACTTCCGGCTGGCGTGCCCCCGAGCTCCTGGTGGATGATGACGGCCCTATATCTCTTGCATCCCAGCATACC
GAGTCTTCGGAGCCGGCTGTGGTGGACCCGCAGACCAACCGCCGCGCCACTCGGGCCATTGACATTTTCTCGCTG
GGTTGTGTGTTCTACTACGTCTTGACTCGTGGCAGCCACCCATTCGACAAAAATGGCAAGTTCATGCGTGAAGCA
AACATCGTCAAGGGCCAATTCGATTTGGAAGAATTAAGCCGCCTAGGCGACTACGCTTTCGAGGCGGATGATCTG
ATCCGCTCAATGCTGTCTCTAGACCCTCGGCAACGGTAAGCACTCTTCTTTGCGGAAACATACCCAACTTACTAA
CATGAATTTCTAGTCCTGATGCAAGCGCTGTATTAATGCACCCGTTCTTCTGGCCCCCATCAGACCGTCTCGCCT
TCCTTTGTGATGTATCTGACCACTTCGAATTTGAGCCCCGCGAGCCTCCATCAGACGCACTGCTTTGTTTGGAAT
CAGTGGCCAAGCGAGTAATGGGTCCCGACATGGATTTCCTGCGCTCATTGCCGCGGGATTTCAAAGACAATCTCG
GCAAGCAGCGCAAATATACCGGGGGGCGGATGCTGGATCTCCTGAGGGCTCTCCGCAACAAGCGCAATCACTACA
ACGATATGCCTGATCATCTTAAGGATAATATTGGTGGCTTGCCTGAAGGATATCTCAATTTCTGGACATACAGGT
TCCCAAGTCTGTTGATGAGCTGTCATTCGGTCATTGTTGAGCTGGATTTAGCTCACAATGATCGCTTCCGGAGGT
ATTTTGTGCCTCCGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail