Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6669.t1
Gene name
Locationscaffold_10:205199..205989
Strand+
Gene length (bp)790
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 80 99 19
3 112 129 17
4 139 161 22
5 174 194 20
6 209 228 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6669.t1
MEESSLLSAILDHRDALASVAEFLRILAGICWTLNYFSMLRTSRKDKIPSTGIFPLCNDIGWEFIYAFIYPTASA
HWEGGVRVWFLVHCIVIIFIIKYAHNEWDHFPLIQRNLYFLYGVVTIGFAIGQYSFAREVGPDLGFFYGGVLCQT
LASLGPIAQILSRNSTRGASLLTWLLRAIATFGGFIKLTIYYLTGNAAGPWFESPMCKFYIGLTLVLDFTYPICY
YVIQRQELANAQKEKKEKSK*
Coding >Pro_DTO070G2_2|g6669.t1
ATGGAGGAATCGAGCCTGCTCTCAGCAATATTGGATCATAGAGATGCCTTGGCATCTGTCGCAGAATTTCTCCGA
ATTCTGGCTGGAATTTGCTGGACTTTAAACTACTTCAGCATGTTGCGCACGTCGCGAAAAGACAAGATTCCCAGC
ACAGGTATCTTTCCTCTCTGCAATGACATTGGGTGGGAATTCATATATGCCTTTATCTACCCAACCGCGAGCGCT
CATTGGGAAGGAGGAGTCCGAGTCTGGTTTTTGGTTCATTGCATCGTCATCATCTTCATCATCAAATATGCGCAC
AATGAGTGGGACCACTTTCCCCTCATTCAACGGAACCTTTACTTCCTATATGGAGTAGTGACTATTGGCTTCGCC
ATCGGCCAATATTCGTTTGCGCGAGAGGTTGGGCCTGACTTGGGATTTTTCTACGGGGGTGTGCTGTGTCAAACG
CTGGCAAGCCTGGGGCCAATTGCTCAGATTCTTTCTCGGAATAGTACCCGCGGTGCTTCCCTATTGACTTGGCTA
TTGAGAGCGATTGCTACTTTTGGTGGATTCATTAAGTTGACTATCTATTACCTCACTGGAAATGCTGCAGGACCT
TGGTTTGAAAGCCCAATGTGCAAGTTCTATATCGGGTTGACCTTGGTTCTTGATTTCACCTATCCGATCTGTTAC
TATGTCATTCAGCGTCAGGAGTTGGCCAATGCTCAGAAGGAGAAAAAGGAGAAGAGCAAATAG
Transcript >Pro_DTO070G2_2|g6669.t1
ATGGAGGAATCGAGCCTGCTCTCAGCAATATTGGATCATAGAGATGCCTTGGCATCTGTCGCAGAATTTCTCCGA
ATTCTGGCTGGAATTTGCTGGACTTTAAACTACTTCAGCATGTTGCGCACGTCGCGAAAAGACAAGATTCCCAGC
ACAGGTATCTTTCCTCTCTGCAATGACATTGGGTGGGAATTCATATATGCCTTTATCTACCCAACCGCGAGCGCT
CATTGGGAAGGAGGAGTCCGAGTCTGGTTTTTGGTTCATTGCATCGTCATCATCTTCATCATCAAATATGCGCAC
AATGAGTGGGACCACTTTCCCCTCATTCAACGGAACCTTTACTTCCTATATGGAGTAGTGACTATTGGCTTCGCC
ATCGGCCAATATTCGTTTGCGCGAGAGGTTGGGCCTGACTTGGGATTTTTCTACGGGGGTGTGCTGTGTCAAACG
CTGGCAAGCCTGGGGCCAATTGCTCAGATTCTTTCTCGGAATAGTACCCGCGGTGCTTCCCTATTGACTTGGCTA
TTGAGAGCGATTGCTACTTTTGGTGGATTCATTAAGTTGACTATCTATTACCTCACTGGAAATGCTGCAGGACCT
TGGTTTGAAAGCCCAATGTGCAAGTTCTATATCGGGTTGACCTTGGTTCTTGATTTCACCTATCCGATCTGTTAC
TATGTCATTCAGCGTCAGGAGTTGGCCAATGCTCAGAAGGAGAAAAAGGAGAAGAGCAAATAG
Gene >Pro_DTO070G2_2|g6669.t1
ATGGAGGAATCGAGCCTGCTCTCAGCAATATTGGATCATAGAGATGCCTTGGCATCTGTCGCAGAATTTCTCCGA
ATTCTGGCTGGAATTTGCTGGACTTTAAACTACTTCAGCATGTTGCGCACGTCGCGAAAAGACAAGATTCCCAGC
ACAGGTATCTTTCCTCTCTGCAATGACATTGGGTGGGAATTCATATATGCCTTTATCTACCCAACCGCGAGCGCT
CATTGGGAAGGAGGAGTCCGAGTCTGGTTTTTGGTTCATTGCATCGTCATCATCTTCATCATCAAATATGCGCAC
AATGAGTGGGACCACTTTCCCCTCATTCAACGGAACCTTTACTTCCTATATGGAGTAGTGACTATTGGCTTCGCC
ATCGGCCAATATTCGTTTGCGCGAGAGGTTGGGCCTGACTTGGGATTTTTCTACGGGGGTGTGCTGTGTCAAACG
CTGGCAAGCCTGGGGCCAATTGCTCAGATTCTTTCTCGGAATAGTACCCGCGGTGCTTCCCTATTGACTTGGTAA
GTTCAAAGCTAGATCAGCTGTTTGCATTCGTCATTGACATGATAAAAGGCTATTGAGAGCGATTGCTACTTTTGG
TGGATTCATTAAGTTGACTATCTATTACCTCACTGGAAATGCTGCAGGACCTTGGTTTGAAAGCCCAATGTGCAA
GTTCTATATCGGGTTGACCTTGGTTCTTGATTTCACCTATCCGATCTGTTACTATGTCATTCAGCGTCAGGAGTT
GGCCAATGCTCAGAAGGAGAAAAAGGAGAAGAGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail