Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6501.t1
Gene name
Locationscaffold_09:663201..665019
Strand-
Gene length (bp)1818
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 1.1E-38 87 423

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 67 89 22
3 96 114 18
4 124 143 19
5 150 167 17
6 177 199 22
7 211 233 22
8 327 349 22
9 362 384 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6501.t1
MGYTYAILALLFPALILLHLLVAPYTKVEESFHVQAVHDILANGLPNGFNDLNLNRTDYDHFSFPGAVPRSALGA
MALAMLSKPVILLNEGINRQILARAILGLLNASSLAIYARGLRHSFGQLTAIWYILLQASQFHLIFYASRPLSNM
FAFSITTLAMFLLLPGPRPTSDQKKCGLALALLTTAGVVFRSELALLVGTQTLFLLATRRINLQHTIIAGLVGLT
TGLALTIYLDSTFWQRFPLWPEFEAFRFNVLAGQSSEWGTEPWSFYFLNSLPRLLSNPLSYLLAIPVALRQPATR
SPALALLIPALSFVALYSFQPHKEWRFIVYIIPSLTAVAALGAAYLWTHRSRSVFARLATRALAITTLATFCLSN
LVLLPASAANYPGGQALDAMHYQHSVLHDTGLRSEKSSAPINVYLGNLACQTGVTRFVQQHPSSGWVYDKTEDKT
VKATSGFWEPFDYVVVEAGDQAGFMDADESSLRRALPASDWERVLVVDSFAGVSILKPGTPATGTAERRVIGAVA
GVRAVGLFEGLREYMRSALLRGWWVEVKMRPRVQVLRRVREGSNV*
Coding >Pro_DTO070G2_2|g6501.t1
ATGGGATATACATATGCGATTCTCGCTCTTCTCTTCCCAGCCTTGATCCTCCTTCATCTCCTCGTCGCTCCATAC
ACCAAAGTCGAGGAGTCGTTCCACGTCCAGGCCGTACATGATATTTTGGCCAACGGGTTGCCAAATGGCTTTAAT
GACCTGAATCTCAATCGCACCGACTATGACCATTTCTCTTTCCCCGGGGCTGTTCCCCGGAGCGCTCTTGGCGCT
ATGGCGCTCGCGATGCTTTCGAAGCCTGTGATCTTGTTGAATGAGGGGATCAACCGACAGATATTAGCTCGAGCT
ATCCTGGGCCTACTCAATGCCTCCTCCCTAGCAATATATGCAAGAGGCCTGCGCCATAGCTTCGGCCAGCTAACA
GCCATCTGGTATATCCTACTCCAAGCAAGCCAGTTCCACTTGATATTCTATGCCTCAAGGCCATTATCAAACATG
TTCGCCTTCAGCATCACAACACTAGCAATGTTTCTGCTTCTCCCAGGCCCTCGTCCAACATCAGACCAAAAGAAA
TGCGGCTTAGCACTCGCGCTCCTCACCACGGCAGGCGTAGTCTTCCGCTCCGAGTTAGCCCTCCTAGTCGGAACC
CAGACTCTCTTCCTGCTAGCAACAAGACGGATCAACCTCCAACACACCATCATCGCGGGCCTAGTAGGCCTCACC
ACCGGGCTCGCCCTCACCATCTATCTCGACAGCACCTTCTGGCAACGCTTCCCCCTCTGGCCGGAGTTCGAAGCC
TTCCGCTTCAACGTCCTAGCAGGCCAGTCCTCCGAATGGGGTACCGAGCCATGGTCCTTCTACTTCCTAAATTCC
CTCCCCCGCCTCCTCTCCAATCCCCTCTCCTACCTCCTCGCCATCCCCGTCGCACTACGCCAACCCGCCACGCGC
TCCCCCGCCCTGGCACTTCTCATCCCGGCGCTTTCCTTCGTCGCCCTGTACAGCTTCCAGCCACACAAGGAATGG
CGCTTCATCGTCTACATCATCCCCTCCCTGACGGCAGTAGCAGCCCTCGGCGCCGCATATCTCTGGACGCACCGC
TCGCGCTCTGTTTTCGCCCGACTGGCGACACGCGCCCTGGCCATTACGACACTCGCCACCTTCTGTCTGTCAAAT
CTCGTGCTCCTTCCTGCGTCTGCGGCAAATTACCCCGGTGGGCAGGCTCTCGACGCCATGCATTATCAACACTCT
GTCCTCCACGATACGGGCTTGCGTTCTGAGAAGAGCAGCGCGCCGATCAATGTCTACTTAGGTAACCTCGCCTGC
CAAACGGGCGTAACGCGCTTCGTGCAACAACACCCTTCGTCGGGGTGGGTATACGACAAAACCGAAGACAAGACT
GTGAAAGCCACTAGTGGGTTCTGGGAGCCGTTCGATTATGTTGTTGTCGAGGCGGGTGATCAGGCCGGGTTCATG
GATGCTGATGAGAGCAGTCTCCGGCGTGCGCTCCCTGCTTCGGACTGGGAGAGGGTGCTTGTGGTAGATTCGTTT
GCGGGGGTCTCGATCTTGAAGCCTGGGACTCCTGCTACGGGAACTGCTGAGCGCCGTGTTATCGGTGCTGTTGCT
GGTGTGCGTGCTGTTGGTTTGTTTGAGGGTCTGCGCGAGTATATGAGGAGTGCTTTGTTGCGTGGGTGGTGGGTT
GAGGTTAAGATGAGACCGAGGGTTCAGGTGTTGAGGCGGGTGAGGGAGGGATCTAATGTTTAG
Transcript >Pro_DTO070G2_2|g6501.t1
ATGGGATATACATATGCGATTCTCGCTCTTCTCTTCCCAGCCTTGATCCTCCTTCATCTCCTCGTCGCTCCATAC
ACCAAAGTCGAGGAGTCGTTCCACGTCCAGGCCGTACATGATATTTTGGCCAACGGGTTGCCAAATGGCTTTAAT
GACCTGAATCTCAATCGCACCGACTATGACCATTTCTCTTTCCCCGGGGCTGTTCCCCGGAGCGCTCTTGGCGCT
ATGGCGCTCGCGATGCTTTCGAAGCCTGTGATCTTGTTGAATGAGGGGATCAACCGACAGATATTAGCTCGAGCT
ATCCTGGGCCTACTCAATGCCTCCTCCCTAGCAATATATGCAAGAGGCCTGCGCCATAGCTTCGGCCAGCTAACA
GCCATCTGGTATATCCTACTCCAAGCAAGCCAGTTCCACTTGATATTCTATGCCTCAAGGCCATTATCAAACATG
TTCGCCTTCAGCATCACAACACTAGCAATGTTTCTGCTTCTCCCAGGCCCTCGTCCAACATCAGACCAAAAGAAA
TGCGGCTTAGCACTCGCGCTCCTCACCACGGCAGGCGTAGTCTTCCGCTCCGAGTTAGCCCTCCTAGTCGGAACC
CAGACTCTCTTCCTGCTAGCAACAAGACGGATCAACCTCCAACACACCATCATCGCGGGCCTAGTAGGCCTCACC
ACCGGGCTCGCCCTCACCATCTATCTCGACAGCACCTTCTGGCAACGCTTCCCCCTCTGGCCGGAGTTCGAAGCC
TTCCGCTTCAACGTCCTAGCAGGCCAGTCCTCCGAATGGGGTACCGAGCCATGGTCCTTCTACTTCCTAAATTCC
CTCCCCCGCCTCCTCTCCAATCCCCTCTCCTACCTCCTCGCCATCCCCGTCGCACTACGCCAACCCGCCACGCGC
TCCCCCGCCCTGGCACTTCTCATCCCGGCGCTTTCCTTCGTCGCCCTGTACAGCTTCCAGCCACACAAGGAATGG
CGCTTCATCGTCTACATCATCCCCTCCCTGACGGCAGTAGCAGCCCTCGGCGCCGCATATCTCTGGACGCACCGC
TCGCGCTCTGTTTTCGCCCGACTGGCGACACGCGCCCTGGCCATTACGACACTCGCCACCTTCTGTCTGTCAAAT
CTCGTGCTCCTTCCTGCGTCTGCGGCAAATTACCCCGGTGGGCAGGCTCTCGACGCCATGCATTATCAACACTCT
GTCCTCCACGATACGGGCTTGCGTTCTGAGAAGAGCAGCGCGCCGATCAATGTCTACTTAGGTAACCTCGCCTGC
CAAACGGGCGTAACGCGCTTCGTGCAACAACACCCTTCGTCGGGGTGGGTATACGACAAAACCGAAGACAAGACT
GTGAAAGCCACTAGTGGGTTCTGGGAGCCGTTCGATTATGTTGTTGTCGAGGCGGGTGATCAGGCCGGGTTCATG
GATGCTGATGAGAGCAGTCTCCGGCGTGCGCTCCCTGCTTCGGACTGGGAGAGGGTGCTTGTGGTAGATTCGTTT
GCGGGGGTCTCGATCTTGAAGCCTGGGACTCCTGCTACGGGAACTGCTGAGCGCCGTGTTATCGGTGCTGTTGCT
GGTGTGCGTGCTGTTGGTTTGTTTGAGGGTCTGCGCGAGTATATGAGGAGTGCTTTGTTGCGTGGGTGGTGGGTT
GAGGTTAAGATGAGACCGAGGGTTCAGGTGTTGAGGCGGGTGAGGGAGGGATCTAATGTTTAG
Gene >Pro_DTO070G2_2|g6501.t1
ATGGGATATAGTTCGTTCGCTCTGTACAACAACACAAGCTAACAAGCTAACGGTTCTTATAGCATATGCGATTCT
CGCTCTTCTCTTCCCAGCCTTGATCCTCCTTCATCTCCTCGTCGCTCCATACACCAAAGTCGAGGAGTCGTTCCA
CGTCCAGGCCGTACATGATATTTTGGCCAACGGGTTGCCAAATGGCTTTAATGACCTGAATCTCAATCGCACCGA
CTATGACCATTTCTCTTTCCCCGGGGCTGTTCCCCGGAGCGCTCTTGGCGCTATGGCGCTCGCGATGCTTTCGAA
GCCTGTGATCTTGTTGAATGAGGGGATCAACCGACAGATATTAGGTACGGCATAGATAATAGTGCGATACATCAA
GCAAACTAACACCGACATCCAGCTCGAGCTATCCTGGGCCTACTCAATGCCTCCTCCCTAGCAATATATGCAAGA
GGCCTGCGCCATAGCTTCGGCCAGCTAACAGCCATCTGGTATATCCTACTCCAAGCAAGCCAGTTCCACTTGATA
TTCTATGCCTCAAGGCCATTATCAAACATGTTCGCCTTCAGCATCACAACACTAGCAATGTTTCTGCTTCTCCCA
GGCCCTCGTCCAACATCAGACCAAAAGAAATGCGGCTTAGCACTCGCGCTCCTCACCACGGCAGGCGTAGTCTTC
CGCTCCGAGTTAGCCCTCCTAGTCGGAACCCAGACTCTCTTCCTGCTAGCAACAAGACGGATCAACCTCCAACAC
ACCATCATCGCGGGCCTAGTAGGCCTCACCACCGGGCTCGCCCTCACCATCTATCTCGACAGCACCTTCTGGCAA
CGCTTCCCCCTCTGGCCGGAGTTCGAAGCCTTCCGCTTCAACGTCCTAGCAGGCCAGTCCTCCGAATGGGGTACC
GAGCCATGGTCCTTCTACTTCCTAAATTCCCTCCCCCGCCTCCTCTCCAATCCCCTCTCCTACCTCCTCGCCATC
CCCGTCGCACTACGCCAACCCGCCACGCGCTCCCCCGCCCTGGCACTTCTCATCCCGGCGCTTTCCTTCGTCGCC
CTGTACAGCTTCCAGCCACACAAGGAATGGCGCTTCATCGTCTACATCATCCCCTCCCTGACGGCAGTAGCAGCC
CTCGGCGCCGCATATCTCTGGACGCACCGCTCGCGCTCTGTTTTCGCCCGACTGGCGACACGCGCCCTGGCCATT
ACGACACTCGCCACCTTCTGTCTGTCAAATCTCGTGCTCCTTCCTGCGTCTGCGGCAAATTACCCCGGTGGGCAG
GCTCTCGACGCCATGCATTATCAACACTCTGTCCTCCACGATACGGGCTTGCGTTCTGAGAAGAGCAGCGCGCCG
ATCAATGTCTACTTAGGTAACCTCGCCTGCCAAACGGGCGTAACGCGCTTCGTGCAACAACACCCTTCGTCGGGG
TGGGTATACGACAAAACCGAAGACAAGACTGTGAAAGCCACTAGTGGGTTCTGGGAGCCGTTCGATTATGTTGTT
GTCGAGGCGGGTGATCAGGCCGGGTTCATGGATGCTGATGAGAGCAGTCTCCGGCGTGCGCTCCCTGCTTCGGAC
TGGGAGAGGGTGCTTGTGGTAGATTCGTTTGCGGGGGTCTCGATCTTGAAGCCTGGGACTCCTGCTACGGGAACT
GCTGAGCGCCGTGTTATCGGTGCTGTTGCTGGTGTGCGTGCTGTTGGTTTGTTTGAGGGTCTGCGCGAGTATATG
AGGAGTGCTTTGTTGCGTGGGTGGTGGGTTGAGGTTAAGATGAGACCGAGGGTTCAGGTGTTGAGGCGGGTGAGG
GAGGGATCTAATGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail