Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g640.t1
Gene name
Locationscaffold_01:1679642..1680216
Strand+
Gene length (bp)574
Transcript length (bp)228
Coding sequence length (bp)228
Protein length (aa) 76

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05493 ATP_synt_H ATP synthase subunit H 3.7E-24 7 66

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:1902600 proton transmembrane transport Yes
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:0015078 proton transmembrane transporter activity No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0005575 cellular_component No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0009987 cellular process No
GO:0034220 ion transmembrane transport No
GO:0098796 membrane protein complex No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006810 transport No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0051179 localization No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0022857 transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0005215 transporter activity No
GO:0006812 cation transport No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0098662 inorganic cation transmembrane transport No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0098660 inorganic ion transmembrane transport No
GO:0022890 inorganic cation transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 39 61 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g640.t1
MANGWSLLIGLVIIVALSTAAWFLSPKGDNQTLFRSTLILTFVSCYLMWAIVFLSQWHPLIAPKRSDIRPDRVPQ
*
Coding >Pro_DTO070G2_2|g640.t1
ATGGCAAACGGCTGGAGCTTGTTAATTGGCCTGGTTATCATTGTCGCCCTCTCGACAGCAGCGTGGTTCCTGAGC
CCGAAGGGCGATAATCAGACCCTCTTCCGCAGCACGCTCATCCTTACCTTCGTTTCTTGTTATTTGATGTGGGCA
ATCGTCTTCCTCTCACAATGGCACCCTCTCATCGCACCAAAGCGGTCAGACATCAGACCTGATCGCGTACCGCAA
TAA
Transcript >Pro_DTO070G2_2|g640.t1
ATGGCAAACGGCTGGAGCTTGTTAATTGGCCTGGTTATCATTGTCGCCCTCTCGACAGCAGCGTGGTTCCTGAGC
CCGAAGGGCGATAATCAGACCCTCTTCCGCAGCACGCTCATCCTTACCTTCGTTTCTTGTTATTTGATGTGGGCA
ATCGTCTTCCTCTCACAATGGCACCCTCTCATCGCACCAAAGCGGTCAGACATCAGACCTGATCGCGTACCGCAA
TAA
Gene >Pro_DTO070G2_2|g640.t1
ATGGCAAACGGGTATGTTTTCCCTCTGTCGGAGTGATGGGATAAACAATGCATATCTATCTCGAGCAATGGATCG
ATGATTACTTGCTTAAGGGTGTTCGCATTGTTCGATCTATCCCGCCACGCGCCGACCCCCGGATACTCTACTCGA
TAAAAGACTATAGTCGCTAACACAAACTTCAACAGCTGGAGCTTGTTAATTGGCCTGGTTATCATTGTCGCCCTC
TCGACAGCAGCGTGGTTCCTGAGCCCGAAGGGCGATAATCAGACGTGAGTCTATGCTTCCCTCTTTGCATACTGG
GCGAGCCCAGCGGCCCTTCCTTTCAAAATTGCAAGCAATTGAGAATACTGACTCTGCTTTCCTTAGCCTCTTCCG
CAGCACGCTCATCCTTACCTTCGTTTCTTGTTATTTGATGTGGGGTACGTTTCTTCTTACCCATGCTCTCTAACC
ACATATCTCTATGATCTGTGTAGATACTAACATAATCAATATAGCAATCGTCTTCCTCTCACAATGGCACCCTCT
CATCGCACCAAAGCGGTCAGACATCAGACCTGATCGCGTACCGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail