Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g6182.t1
Gene name
Locationscaffold_08:878060..879591
Strand-
Gene length (bp)1531
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03345 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit beta 5.0E-152 25 443

GO

GO Term Description Terminal node
GO:0018279 protein N-linked glycosylation via asparagine Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0018193 peptidyl-amino acid modification No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016020 membrane No
GO:0043413 macromolecule glycosylation No
GO:0070085 glycosylation No
GO:0036211 protein modification process No
GO:0043412 macromolecule modification No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0018196 peptidyl-asparagine modification No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006486 protein glycosylation No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No
GO:0006487 protein N-linked glycosylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 420 442 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g6182.t1
MRWCLALLICCFLAAVNALSSSGSRLLAILEDTEQKDLYSTLWADLEARGYDVSIESSKSEQLALFKLGERAYDH
LLIFPPKSKGLGPSLTPKHIVDFMNKDGNILLALSGKSATSSAISSLLLELDIHLSNDRSQVVVDHFNYDTLSAA
EKHDVLVLQRPGPLRSDVKAFFDGEGVLALPRVAPQTLGDSALLSPILKAPATAYSYNPKEGTPAPEDILATGSQ
LNIISAMQARNSARFTVLGSVESLEDKWFSASVKTPSGKKTPTVNREFAKQLTAWAFKETGVLKVDKVEHRLITE
GAELNPSIYRIKNETIYSIEISEYVYDKWVPFELPGDDALQLEFTMLSPFHRLNLEPVERTDSSTVFSTQFVTPD
QHGIFSFRVNYKRPFLTAIEEKLEVTNRHFAHDEYPRSWAITGGWVWIAGLWSVIGGFLAFVVVWLYSAPVADKL
KKTQ*
Coding >Pro_DTO070G2_2|g6182.t1
ATGAGGTGGTGTCTTGCGTTGCTTATTTGTTGCTTCTTGGCTGCGGTAAATGCGCTGAGTAGCTCCGGCAGTCGC
CTGTTGGCTATTTTGGAAGATACAGAACAAAAGGACCTGTACTCCACGTTGTGGGCAGACCTAGAAGCACGAGGA
TACGATGTCTCAATCGAATCTTCCAAGAGTGAACAGCTTGCCTTGTTCAAGCTTGGCGAAAGAGCTTACGACCAC
CTTCTAATCTTCCCTCCCAAGTCAAAAGGCCTCGGCCCCTCCTTGACCCCCAAACACATCGTCGACTTTATGAAC
AAGGATGGAAACATCCTCCTCGCCCTTTCTGGCAAGTCTGCCACCTCCAGCGCCATCAGCTCCCTTCTCCTCGAA
CTCGATATTCACCTATCCAACGATCGCTCACAAGTTGTTGTCGACCACTTCAACTATGACACCCTCTCGGCCGCT
GAGAAGCATGACGTTCTTGTCCTGCAGCGCCCTGGACCCCTCCGTTCTGACGTCAAGGCCTTCTTTGATGGTGAG
GGTGTTCTTGCTCTCCCTCGAGTTGCTCCCCAGACTCTCGGTGACAGCGCCCTGCTCTCTCCGATTCTCAAGGCC
CCCGCCACTGCCTACAGCTACAACCCCAAGGAGGGCACGCCCGCGCCGGAGGATATCCTGGCTACCGGGTCGCAG
CTGAATATCATTTCCGCTATGCAGGCACGTAACTCTGCCCGCTTCACTGTTCTCGGATCAGTGGAGTCGCTGGAG
GACAAGTGGTTCTCGGCCTCCGTCAAGACGCCCAGCGGCAAGAAGACACCTACCGTGAACCGCGAGTTCGCCAAG
CAGTTGACTGCTTGGGCTTTCAAGGAGACTGGTGTCCTGAAGGTTGACAAGGTCGAGCATCGCCTTATCACTGAG
GGCGCAGAGTTGAACCCCTCGATCTACCGGATCAAGAACGAGACTATCTACAGCATTGAGATTTCCGAGTATGTC
TACGATAAGTGGGTTCCCTTTGAACTACCTGGAGACGACGCGCTCCAGCTCGAGTTCACCATGCTCTCGCCCTTC
CACCGCCTGAACCTGGAACCGGTCGAGCGCACCGATTCCAGCACTGTGTTCAGCACTCAGTTCGTGACTCCCGAT
CAACACGGAATCTTCTCCTTCCGCGTCAACTACAAGCGTCCCTTCTTGACCGCCATCGAGGAGAAGCTTGAGGTT
ACCAACCGCCACTTCGCGCACGACGAGTACCCGCGCAGCTGGGCTATTACCGGCGGCTGGGTATGGATTGCCGGT
CTTTGGTCGGTAATTGGAGGATTCTTGGCTTTCGTGGTTGTCTGGCTCTACTCTGCCCCTGTGGCCGATAAGCTC
AAGAAGACTCAGTAG
Transcript >Pro_DTO070G2_2|g6182.t1
ATGAGGTGGTGTCTTGCGTTGCTTATTTGTTGCTTCTTGGCTGCGGTAAATGCGCTGAGTAGCTCCGGCAGTCGC
CTGTTGGCTATTTTGGAAGATACAGAACAAAAGGACCTGTACTCCACGTTGTGGGCAGACCTAGAAGCACGAGGA
TACGATGTCTCAATCGAATCTTCCAAGAGTGAACAGCTTGCCTTGTTCAAGCTTGGCGAAAGAGCTTACGACCAC
CTTCTAATCTTCCCTCCCAAGTCAAAAGGCCTCGGCCCCTCCTTGACCCCCAAACACATCGTCGACTTTATGAAC
AAGGATGGAAACATCCTCCTCGCCCTTTCTGGCAAGTCTGCCACCTCCAGCGCCATCAGCTCCCTTCTCCTCGAA
CTCGATATTCACCTATCCAACGATCGCTCACAAGTTGTTGTCGACCACTTCAACTATGACACCCTCTCGGCCGCT
GAGAAGCATGACGTTCTTGTCCTGCAGCGCCCTGGACCCCTCCGTTCTGACGTCAAGGCCTTCTTTGATGGTGAG
GGTGTTCTTGCTCTCCCTCGAGTTGCTCCCCAGACTCTCGGTGACAGCGCCCTGCTCTCTCCGATTCTCAAGGCC
CCCGCCACTGCCTACAGCTACAACCCCAAGGAGGGCACGCCCGCGCCGGAGGATATCCTGGCTACCGGGTCGCAG
CTGAATATCATTTCCGCTATGCAGGCACGTAACTCTGCCCGCTTCACTGTTCTCGGATCAGTGGAGTCGCTGGAG
GACAAGTGGTTCTCGGCCTCCGTCAAGACGCCCAGCGGCAAGAAGACACCTACCGTGAACCGCGAGTTCGCCAAG
CAGTTGACTGCTTGGGCTTTCAAGGAGACTGGTGTCCTGAAGGTTGACAAGGTCGAGCATCGCCTTATCACTGAG
GGCGCAGAGTTGAACCCCTCGATCTACCGGATCAAGAACGAGACTATCTACAGCATTGAGATTTCCGAGTATGTC
TACGATAAGTGGGTTCCCTTTGAACTACCTGGAGACGACGCGCTCCAGCTCGAGTTCACCATGCTCTCGCCCTTC
CACCGCCTGAACCTGGAACCGGTCGAGCGCACCGATTCCAGCACTGTGTTCAGCACTCAGTTCGTGACTCCCGAT
CAACACGGAATCTTCTCCTTCCGCGTCAACTACAAGCGTCCCTTCTTGACCGCCATCGAGGAGAAGCTTGAGGTT
ACCAACCGCCACTTCGCGCACGACGAGTACCCGCGCAGCTGGGCTATTACCGGCGGCTGGGTATGGATTGCCGGT
CTTTGGTCGGTAATTGGAGGATTCTTGGCTTTCGTGGTTGTCTGGCTCTACTCTGCCCCTGTGGCCGATAAGCTC
AAGAAGACTCAGTAG
Gene >Pro_DTO070G2_2|g6182.t1
ATGAGGTGGTGTCTTGCGTTGCTTATTTGTTGCTTCTTGGCTGCGGTAAATGCGCTGAGTAGCTCCGGCAGTCGC
CTGTTGGCTATTTTGGAAGATACAGAACAAAAGGACCTGTACTCCACGTTGTGGGCAGACCTAGAAGGTAATTAA
TCTGACTCAATTTATTGATCCTTTGCTAACTCTCGGACTCCAGCACGAGGATACGATGTCTCAATCGAATCTTCC
AAGAGTGAACAGCTTGCCTTGTTCAAGCTTGGCGAAAGAGCTTACGACCACCTTCTAATCTTCCCTCCCAAGTCA
AAAGGTGCGCAAACCCGACTATTGATTCGATGTCTAGTCAATTGACCTAAGAATACAGGCCTCGGCCCCTCCTTG
ACCCCCAAACACATCGTCGACTTTATGAACAAGGATGGAAACATCCTCCTCGCCCTTTCTGGCAAGTCTGCCACC
TCCAGCGCCATCAGCTCCCTTCTCCTCGAACTCGATATTCACCTATCCAACGATCGCTCACAAGTTGTTGTCGAC
CACTTCAACTATGACACCCTCTCGGCCGCTGAGAAGCATGACGTTCTTGTCCTGCAGCGCCCTGGACCCCTCCGT
TCTGACGTCAAGGCCTTCTTTGATGGTGAGGGTGTTCTTGCTCTCCCTCGAGTTGCTCCCCAGACTCTCGGTGAC
AGCGCCCTGCTCTCTCCGATTCTCAAGGCCCCCGCCACTGCCTACAGCTACAACCCCAAGGAGGGCACGCCCGCG
CCGGAGGATATCCTGGCTACCGGGTCGCAGCTGAATATCATTTCCGCTATGCAGGCACGTAACTCTGCCCGCTTC
ACTGTTCTCGGATCAGTGGAGTCGCTGGAGGACAAGTGGTTCTCGGCCTCCGTCAAGACGCCCAGCGGCAAGAAG
ACACCTACCGTGAACCGCGAGTTCGCCAAGCAGTTGACTGCTTGGGCTTTCAAGGAGACTGGTGTCCTGAAGGTT
GACAAGGTCGAGCATCGCCTTATCACTGAGGGCGCAGAGTTGAACCCCTCGATCTACCGGATCAAGAACGAGACT
GTACGTGAAACAATATATTGTCATTCTCTTCCAAGCTAACATGAGCCTTATTTGCCTGCAGATCTACAGCATTGA
GATTTCCGAGTATGTCTACGATAAGTGGGTTCCCTTTGAACTACCTGGAGACGACGCGCTCCAGCTCGAGTTCAC
CATGCTCTCGCCCTTCCACCGCCTGAACCTGGAACCGGTCGAGCGCACCGATTCCAGCACTGTGTTCAGCACTCA
GTTCGTGACTCCCGATCAACACGGAATCTTCTCCTTCCGCGTCAACTACAAGCGTCCCTTCTTGACCGCCATCGA
GGAGAAGCTTGAGGTTACCAACCGCCACTTCGCGCACGACGAGTACCCGCGCAGCTGGGCTATTACCGGCGGCTG
GGTATGGATTGCCGGTCTTTGGTCGGTAATTGGAGGATTCTTGGCTTTCGTGGTTGTCTGGCTCTACTCTGCCCC
TGTGGCCGATAAGCTCAAGAAGACTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail