Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5927.t1
Gene name
Locationscaffold_08:181435..183163
Strand+
Gene length (bp)1728
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 9.2E-31 32 132
PF00085 Thioredoxin Thioredoxin 1.8E-26 366 472
PF13848 Thioredoxin_6 Thioredoxin-like domain 2.1E-06 68 159
PF13848 Thioredoxin_6 Thioredoxin-like domain 8.5E-32 165 343
PF01216 Calsequestrin Calsequestrin 1.4E-12 70 247

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5927.t1
MRSFAPLVLSLLGATAAVHAAEPEVADTDANVVTLTTETFDEFVKEHPLVLAEFYAPWCGHCKALAPHYEEAATE
LKAKDIPVIKVDCTVEEELCRTYEVDGYPTLKVFRGPDAHKPYAGARKSDAIISYMTKQSMPAVSNVNEENLEEF
KALDKIVIIGYVASDDSASNKSFTSFAESQRDNFLFAASNDAALAKAEGAKQPSIVLYKEFDEKVAVYDGKLEEE
AILEWVKTASTPLVGELGPETYSKYMAAGIPLAYIFAETPEEREQLAADFRPIAENHRGAINIVTLDAKLFGAHA
GNLNLEPEKFPAFAIQDTTKNAKYPYDQTKKVDAKDIGKFIKDVLEGKVEPSLKSEPIPETQEGSVTVVVGRNYQ
EVVVDNEKDVLVEFYAPWCGHCKSLAPKYEELAALYADVPELNEKVTVAKVDATANDVPDSITGFPTIKLYPAGA
KDSPIEYSGSRTVEDLVAFIKENGKYQADGLADGSKKPEERAEVTSAPKATESPASDEKDIHDEL*
Coding >Pro_DTO070G2_2|g5927.t1
ATGCGGTCTTTCGCCCCTCTGGTCCTGAGCCTTCTCGGAGCTACTGCGGCAGTCCACGCTGCTGAGCCTGAAGTT
GCCGACACTGACGCCAATGTCGTCACCTTGACAACCGAAACCTTTGATGAATTCGTCAAGGAGCACCCTTTGGTG
CTTGCTGAGTTCTATGCGCCTTGGTGCGGTCACTGCAAGGCCCTTGCACCCCATTATGAGGAGGCTGCCACAGAG
CTGAAGGCCAAGGATATCCCCGTGATCAAGGTGGATTGCACCGTGGAAGAGGAGCTCTGCCGAACCTACGAAGTT
GATGGCTACCCTACTCTGAAGGTATTCCGTGGCCCCGATGCACACAAGCCCTACGCTGGTGCCCGCAAGTCCGAC
GCAATCATTTCATACATGACCAAGCAGTCTATGCCCGCCGTCTCGAACGTGAACGAGGAGAACCTAGAGGAATTC
AAGGCCTTGGACAAGATTGTTATTATTGGATACGTGGCTTCTGACGACAGCGCCTCCAACAAGAGCTTCACTTCG
TTCGCTGAATCCCAGCGTGACAACTTCCTCTTCGCTGCCTCCAACGATGCTGCTCTCGCTAAGGCCGAGGGCGCC
AAGCAGCCCTCGATTGTTCTCTACAAGGAATTCGATGAGAAGGTGGCCGTTTACGACGGAAAGCTGGAGGAAGAG
GCCATCCTTGAATGGGTCAAGACCGCTAGTACTCCTCTTGTTGGCGAGCTTGGTCCCGAGACTTACTCAAAGTAC
ATGGCGGCCGGTATTCCCCTGGCTTACATCTTTGCCGAGACTCCCGAGGAGCGCGAGCAGCTCGCTGCTGATTTC
CGTCCCATCGCTGAGAACCACCGTGGAGCTATCAACATTGTTACCCTTGATGCTAAGCTCTTCGGCGCTCACGCC
GGCAACCTTAACCTTGAGCCCGAGAAGTTCCCTGCTTTCGCTATCCAGGACACTACTAAGAACGCCAAGTACCCT
TACGATCAGACTAAGAAGGTTGATGCCAAGGATATCGGCAAGTTCATCAAGGATGTCCTTGAGGGCAAGGTTGAG
CCTAGCCTCAAGTCCGAGCCCATTCCCGAGACTCAGGAGGGATCTGTTACTGTTGTTGTTGGCCGCAACTACCAG
GAGGTTGTCGTTGATAACGAAAAGGATGTGCTGGTCGAGTTCTACGCTCCCTGGTGCGGACACTGCAAGTCTCTT
GCTCCCAAGTACGAAGAGCTTGCTGCGTTGTATGCCGATGTCCCCGAGTTGAATGAGAAGGTCACTGTCGCCAAA
GTCGACGCCACTGCCAACGATGTGCCAGATTCCATCACTGGCTTCCCCACCATCAAGCTCTACCCCGCTGGTGCT
AAGGACTCACCTATTGAGTACTCTGGTTCCCGTACCGTGGAGGACCTAGTCGCCTTCATCAAGGAGAACGGCAAG
TATCAGGCGGACGGCCTGGCCGATGGCTCCAAGAAGCCCGAGGAGCGTGCCGAGGTCACTTCGGCCCCCAAGGCC
ACCGAGTCTCCCGCATCCGATGAGAAGGATATTCATGACGAGCTTTAA
Transcript >Pro_DTO070G2_2|g5927.t1
ATGCGGTCTTTCGCCCCTCTGGTCCTGAGCCTTCTCGGAGCTACTGCGGCAGTCCACGCTGCTGAGCCTGAAGTT
GCCGACACTGACGCCAATGTCGTCACCTTGACAACCGAAACCTTTGATGAATTCGTCAAGGAGCACCCTTTGGTG
CTTGCTGAGTTCTATGCGCCTTGGTGCGGTCACTGCAAGGCCCTTGCACCCCATTATGAGGAGGCTGCCACAGAG
CTGAAGGCCAAGGATATCCCCGTGATCAAGGTGGATTGCACCGTGGAAGAGGAGCTCTGCCGAACCTACGAAGTT
GATGGCTACCCTACTCTGAAGGTATTCCGTGGCCCCGATGCACACAAGCCCTACGCTGGTGCCCGCAAGTCCGAC
GCAATCATTTCATACATGACCAAGCAGTCTATGCCCGCCGTCTCGAACGTGAACGAGGAGAACCTAGAGGAATTC
AAGGCCTTGGACAAGATTGTTATTATTGGATACGTGGCTTCTGACGACAGCGCCTCCAACAAGAGCTTCACTTCG
TTCGCTGAATCCCAGCGTGACAACTTCCTCTTCGCTGCCTCCAACGATGCTGCTCTCGCTAAGGCCGAGGGCGCC
AAGCAGCCCTCGATTGTTCTCTACAAGGAATTCGATGAGAAGGTGGCCGTTTACGACGGAAAGCTGGAGGAAGAG
GCCATCCTTGAATGGGTCAAGACCGCTAGTACTCCTCTTGTTGGCGAGCTTGGTCCCGAGACTTACTCAAAGTAC
ATGGCGGCCGGTATTCCCCTGGCTTACATCTTTGCCGAGACTCCCGAGGAGCGCGAGCAGCTCGCTGCTGATTTC
CGTCCCATCGCTGAGAACCACCGTGGAGCTATCAACATTGTTACCCTTGATGCTAAGCTCTTCGGCGCTCACGCC
GGCAACCTTAACCTTGAGCCCGAGAAGTTCCCTGCTTTCGCTATCCAGGACACTACTAAGAACGCCAAGTACCCT
TACGATCAGACTAAGAAGGTTGATGCCAAGGATATCGGCAAGTTCATCAAGGATGTCCTTGAGGGCAAGGTTGAG
CCTAGCCTCAAGTCCGAGCCCATTCCCGAGACTCAGGAGGGATCTGTTACTGTTGTTGTTGGCCGCAACTACCAG
GAGGTTGTCGTTGATAACGAAAAGGATGTGCTGGTCGAGTTCTACGCTCCCTGGTGCGGACACTGCAAGTCTCTT
GCTCCCAAGTACGAAGAGCTTGCTGCGTTGTATGCCGATGTCCCCGAGTTGAATGAGAAGGTCACTGTCGCCAAA
GTCGACGCCACTGCCAACGATGTGCCAGATTCCATCACTGGCTTCCCCACCATCAAGCTCTACCCCGCTGGTGCT
AAGGACTCACCTATTGAGTACTCTGGTTCCCGTACCGTGGAGGACCTAGTCGCCTTCATCAAGGAGAACGGCAAG
TATCAGGCGGACGGCCTGGCCGATGGCTCCAAGAAGCCCGAGGAGCGTGCCGAGGTCACTTCGGCCCCCAAGGCC
ACCGAGTCTCCCGCATCCGATGAGAAGGATATTCATGACGAGCTTTAA
Gene >Pro_DTO070G2_2|g5927.t1
ATGCGGTCTTTCGCCCCTCTGGTCCTGAGCCTTCTCGGAGCTACTGCGGCAGTCCACGCTGCTGAGCCTGAAGTT
GCCGACACTGACGCCAATGTCGTCACCTTGACAACCGAAACCTTTGATGAATTCGTCAAGGAGCACCCTTTGGTG
CTTGCTGAGTTCTATGCGCCTTGGTGCGGTCACTGCAAGGCCCTTGCACCCCATTATGAGGAGGCTGCCACAGAG
CTGAAGGCCAAGGATATCCCCGTGATCAAGGTGGATTGCACCGTGGAAGAGGAGCTCTGCCGAACCTACGAAGTT
GATGGCTACCCTACTCTGAAGGTATTCCGTGGCCCCGATGCACACAAGCCCTACGCTGGTGCCCGCAAGTCCGAC
GCGTAAGTCATTCTAGGTTTCGGGTTCTTGTGCTCTGGAAATTAACGCGTTTCCTCGATAGAATCATTTCATACA
TGACCAAGCAGTCTATGCCCGCCGTCTCGAACGTGAACGAGGAGAACCTAGAGGAATTCAAGGCCTTGGACAAGA
TTGTTATTATTGGATACGTGGCTTCTGACGACAGCGCCTCCAACAAGAGCTTCACTTCGTTCGCTGAATCCCAGC
GTGACAACTTCCTCTTCGCTGCCTCCAACGATGCTGCTCTCGCTAAGGCCGAGGGCGCCAAGCAGCCCTCGATTG
TTCTCTACAAGGAATTCGATGAGAAGGTGGCCGTTTACGACGGAAAGCTGGAGGAAGAGGCCATCCTTGAATGGG
TCAAGACCGCTAGTACTCCTCTTGTTGGCGAGCTTGGTCCCGAGACTTACTCAAAGTACATGGCGGTATGTCTAA
CTTCTTCTGTCCTCGTATTTGAGCAAGAAAAGAAACTGACTTTCTACAACGATTAGGCCGGTATTCCCCTGGCTT
ACATCTTTGCCGAGACTCCCGAGGAGCGCGAGCAGCTCGCTGCTGATTTCCGTCCCATCGCTGAGAACCACCGTG
GAGCTATCAACATTGTTACCCTTGATGCTAAGCTCTTCGGCGCTCACGCCGGCAACCTTAACCTTGAGCCCGAGA
AGTTCCCTGCTTTCGCTATCCAGGACACTACTAAGAACGCCAAGTACCCTTACGATCAGACTAAGAAGGTTGATG
CCAAGGATATCGGCAAGTTCATCAAGGATGTCCTTGAGGGCAAGGTTGAGCCTAGCCTCAAGTCCGAGCCCATTC
CCGAGACTCAGGAGGGATCTGTTACTGTTGTTGTTGGCCGCAACTACCAGGAGGTTGTCGTTGATAACGAAAAGG
ATGTGCTGGTCGAGTTCTACGCTCCCTGGTGCGGACACTGCAAGTCGTAAGTTTTTCACACCTCATCTACCATTT
GTCGCATGTCTAACTCATCATCACAGTCTTGCTCCCAAGTACGAAGAGCTTGCTGCGTTGTATGCCGATGTCCCC
GAGTTGAATGAGAAGGTCACTGTCGCCAAAGTCGACGCCACTGCCAACGATGTGCCAGATTCCATCACTGGCTTC
CCCACCATCAAGCTCTACCCCGCTGGTGCTAAGGACTCACCTATTGAGTACTCTGGTTCCCGTACCGTGGAGGAC
CTAGTCGCCTTCATCAAGGAGAACGGCAAGTATCAGGCGGACGGCCTGGCCGATGGCTCCAAGAAGCCCGAGGAG
CGTGCCGAGGTCACTTCGGCCCCCAAGGCCACCGAGTCTCCCGCATCCGATGAGAAGGATATTCATGACGAGCTT
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail