Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5820.t1
Gene name
Locationscaffold_07:1053997..1056688
Strand+
Gene length (bp)2691
Transcript length (bp)2499
Coding sequence length (bp)2499
Protein length (aa) 833

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 8.5E-05 132 161
PF08238 Sel1 Sel1 repeat 5.3E-03 172 205
PF08238 Sel1 Sel1 repeat 3.5E-03 214 240
PF08238 Sel1 Sel1 repeat 3.3E+00 314 341
PF08238 Sel1 Sel1 repeat 3.9E+00 373 402
PF08238 Sel1 Sel1 repeat 1.4E-05 405 438
PF08238 Sel1 Sel1 repeat 4.3E+00 595 626
PF08238 Sel1 Sel1 repeat 3.6E-02 631 663

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 761 780 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5820.t1
MRTPLSHFLSALLLLQTCAAGPGQPLTDQTASAATGRDADHEFTFLAGEAEPRPMTQRVENAWNTLRTIKNPVLQ
SDKSRGLLGTVTYYGRQTVRLLFLNRPSTEKPEQKINKHLTGAVEELRIAADEDRDPDAMFLLAEMNFYGNFSHP
RDFKEAFRWYHELAWLDGNNTAQNMVGFMYATGIGGAVEPDQAKALMYHEFAAETGNIRSEMTLAYRYHTGIGTP
KDCDHAIHYYKKVADKAVEYYRSGPPGGRSMVRESYRWADEEGGVYGPGASVSSSGQNARDAANASPEASVEDIL
EYLDLMSRKGELKATYTLGKMNFEGARGLPRNFRLAMKHFKVVTKKYWNKDGSVNSNPPAGLDKLASKAAGHIGL
MYLRGEGVKQHFPTALTWFRRGITNGDPMCQHWMGLMYLKGYGIPQDAFKASHYFKAAAEQDSPASESRLGALFL
DQGDVATATRYFELAARWGWMEAYYYLAEMANFGIGRQRHCGVAAAYYKMVAEKAEIVHSAFVEANAAYETGDKE
GALIPSMMAAEQGYENAQANVAYLLDEHRSVLSLNSILPWAEKARSSLMRNARLALIYWTRSSKQANIDSLVKMG
DYYLSGTGTPIDADKASTCYHNAAEAHHSAQGYWNLGWMHENGVAVDQDFHMAKRYYDLALDLSPEAYLPVKLSL
IKLRARGYWNRITNGDINPIHEEEDSKPRRTFKEWVKAFIENDEDGYYEDLYELQRGDDDEYRGLESEGHEDGYY
DDLDLDIDEGMLEGLLIVGLAAALLVLVYYRQQQQRNRQNQNANANANANAPNGDGNANDRGLFPQPGEPDFGQW
VAGGVGH*
Coding >Pro_DTO070G2_2|g5820.t1
ATGAGGACGCCGCTTTCACACTTTCTCTCGGCCCTGCTGCTATTGCAGACATGCGCAGCTGGGCCTGGTCAGCCG
CTTACTGACCAAACAGCGTCCGCGGCAACGGGCCGCGATGCAGACCACGAATTTACGTTCCTGGCAGGGGAAGCA
GAACCCCGACCTATGACTCAACGAGTCGAGAATGCCTGGAATACCCTTCGCACAATAAAGAATCCAGTCCTTCAA
TCCGACAAGTCGAGAGGATTACTAGGGACGGTCACATACTATGGCCGTCAAACGGTCCGACTGCTATTCTTGAAC
CGCCCTTCGACTGAAAAACCCGAGCAGAAAATAAACAAACATCTGACGGGAGCAGTGGAGGAGCTGAGAATAGCT
GCAGACGAAGACCGAGACCCGGATGCTATGTTCTTGTTAGCAGAGATGAACTTCTATGGCAACTTCTCCCATCCC
CGCGATTTCAAAGAGGCCTTCCGCTGGTACCACGAACTAGCATGGTTGGACGGAAACAACACAGCGCAGAACATG
GTCGGGTTCATGTATGCGACGGGCATCGGCGGTGCGGTCGAACCCGACCAGGCAAAGGCCCTGATGTACCACGAA
TTTGCAGCGGAAACAGGGAACATTCGCTCGGAGATGACACTTGCGTATCGCTACCACACTGGTATCGGAACGCCG
AAGGATTGTGACCATGCGATCCATTACTACAAGAAGGTTGCGGACAAGGCGGTCGAGTACTACCGCTCAGGCCCT
CCGGGTGGTAGGTCTATGGTTCGAGAATCTTATCGTTGGGCAGACGAAGAAGGTGGTGTCTACGGTCCAGGAGCC
AGTGTGTCGAGCTCGGGTCAAAATGCGCGGGACGCTGCCAATGCCTCTCCTGAGGCCAGCGTGGAAGATATACTA
GAATACTTGGATCTCATGTCCCGGAAGGGTGAACTGAAGGCTACATACACCCTCGGTAAGATGAACTTCGAGGGC
GCCCGGGGCTTGCCGCGGAATTTCCGACTGGCTATGAAGCATTTCAAGGTTGTTACCAAGAAATATTGGAACAAG
GATGGGTCCGTCAACTCAAACCCCCCTGCAGGGCTTGATAAACTGGCATCCAAGGCCGCAGGACATATTGGCCTG
ATGTACCTTCGCGGAGAGGGTGTTAAGCAACACTTCCCGACTGCCCTCACATGGTTCCGGAGGGGTATTACGAAC
GGGGACCCGATGTGCCAGCATTGGATGGGTCTGATGTATCTCAAGGGCTATGGTATTCCGCAGGATGCCTTCAAG
GCATCTCACTACTTCAAAGCAGCGGCAGAGCAGGATTCCCCTGCGTCAGAATCACGATTAGGCGCTCTGTTCTTG
GACCAAGGAGATGTGGCAACCGCAACACGTTACTTCGAGCTTGCCGCCCGCTGGGGCTGGATGGAGGCGTACTAT
TATCTAGCTGAGATGGCCAACTTCGGTATTGGCAGACAGCGTCACTGTGGTGTGGCCGCTGCCTACTATAAAATG
GTTGCCGAAAAAGCAGAGATCGTCCACTCAGCTTTCGTGGAGGCAAACGCTGCTTACGAAACCGGTGATAAGGAG
GGCGCTCTCATTCCGTCAATGATGGCAGCCGAGCAAGGCTATGAGAACGCACAGGCAAATGTGGCTTATCTGCTT
GATGAGCATCGCTCCGTACTCTCACTAAATTCCATCCTTCCATGGGCTGAGAAGGCTCGATCCTCCTTGATGCGC
AATGCGCGACTGGCCTTGATTTATTGGACCCGCTCTTCGAAGCAAGCCAACATCGACTCTTTGGTCAAGATGGGT
GACTACTACCTGTCTGGTACTGGTACACCTATCGATGCCGACAAGGCCTCGACCTGTTACCACAATGCTGCTGAA
GCCCACCACAGTGCCCAGGGCTACTGGAATTTGGGATGGATGCATGAGAATGGCGTGGCAGTAGATCAGGATTTC
CACATGGCCAAGCGATATTATGATTTGGCTCTTGACCTCAGCCCCGAAGCGTATCTGCCAGTGAAGCTCAGCTTG
ATCAAACTCCGGGCTCGAGGATACTGGAATCGCATCACTAACGGAGACATTAACCCCATCCATGAGGAGGAAGAC
TCGAAGCCCCGTCGTACCTTCAAGGAATGGGTCAAGGCTTTCATCGAGAACGACGAGGATGGCTATTACGAAGAC
CTTTATGAACTACAACGGGGTGATGATGATGAATATCGTGGCTTGGAATCCGAAGGCCACGAAGATGGCTACTAT
GATGACCTGGACCTTGATATCGACGAGGGAATGCTCGAGGGTCTCCTCATTGTCGGACTGGCTGCTGCGCTGTTG
GTTTTGGTATACTACCGTCAGCAGCAGCAGCGCAACCGACAGAACCAGAACGCCAATGCCAACGCTAACGCCAAT
GCCCCGAATGGAGATGGGAATGCCAACGACCGTGGATTATTCCCTCAGCCTGGTGAACCTGACTTTGGGCAATGG
GTAGCAGGAGGAGTTGGTCATTGA
Transcript >Pro_DTO070G2_2|g5820.t1
ATGAGGACGCCGCTTTCACACTTTCTCTCGGCCCTGCTGCTATTGCAGACATGCGCAGCTGGGCCTGGTCAGCCG
CTTACTGACCAAACAGCGTCCGCGGCAACGGGCCGCGATGCAGACCACGAATTTACGTTCCTGGCAGGGGAAGCA
GAACCCCGACCTATGACTCAACGAGTCGAGAATGCCTGGAATACCCTTCGCACAATAAAGAATCCAGTCCTTCAA
TCCGACAAGTCGAGAGGATTACTAGGGACGGTCACATACTATGGCCGTCAAACGGTCCGACTGCTATTCTTGAAC
CGCCCTTCGACTGAAAAACCCGAGCAGAAAATAAACAAACATCTGACGGGAGCAGTGGAGGAGCTGAGAATAGCT
GCAGACGAAGACCGAGACCCGGATGCTATGTTCTTGTTAGCAGAGATGAACTTCTATGGCAACTTCTCCCATCCC
CGCGATTTCAAAGAGGCCTTCCGCTGGTACCACGAACTAGCATGGTTGGACGGAAACAACACAGCGCAGAACATG
GTCGGGTTCATGTATGCGACGGGCATCGGCGGTGCGGTCGAACCCGACCAGGCAAAGGCCCTGATGTACCACGAA
TTTGCAGCGGAAACAGGGAACATTCGCTCGGAGATGACACTTGCGTATCGCTACCACACTGGTATCGGAACGCCG
AAGGATTGTGACCATGCGATCCATTACTACAAGAAGGTTGCGGACAAGGCGGTCGAGTACTACCGCTCAGGCCCT
CCGGGTGGTAGGTCTATGGTTCGAGAATCTTATCGTTGGGCAGACGAAGAAGGTGGTGTCTACGGTCCAGGAGCC
AGTGTGTCGAGCTCGGGTCAAAATGCGCGGGACGCTGCCAATGCCTCTCCTGAGGCCAGCGTGGAAGATATACTA
GAATACTTGGATCTCATGTCCCGGAAGGGTGAACTGAAGGCTACATACACCCTCGGTAAGATGAACTTCGAGGGC
GCCCGGGGCTTGCCGCGGAATTTCCGACTGGCTATGAAGCATTTCAAGGTTGTTACCAAGAAATATTGGAACAAG
GATGGGTCCGTCAACTCAAACCCCCCTGCAGGGCTTGATAAACTGGCATCCAAGGCCGCAGGACATATTGGCCTG
ATGTACCTTCGCGGAGAGGGTGTTAAGCAACACTTCCCGACTGCCCTCACATGGTTCCGGAGGGGTATTACGAAC
GGGGACCCGATGTGCCAGCATTGGATGGGTCTGATGTATCTCAAGGGCTATGGTATTCCGCAGGATGCCTTCAAG
GCATCTCACTACTTCAAAGCAGCGGCAGAGCAGGATTCCCCTGCGTCAGAATCACGATTAGGCGCTCTGTTCTTG
GACCAAGGAGATGTGGCAACCGCAACACGTTACTTCGAGCTTGCCGCCCGCTGGGGCTGGATGGAGGCGTACTAT
TATCTAGCTGAGATGGCCAACTTCGGTATTGGCAGACAGCGTCACTGTGGTGTGGCCGCTGCCTACTATAAAATG
GTTGCCGAAAAAGCAGAGATCGTCCACTCAGCTTTCGTGGAGGCAAACGCTGCTTACGAAACCGGTGATAAGGAG
GGCGCTCTCATTCCGTCAATGATGGCAGCCGAGCAAGGCTATGAGAACGCACAGGCAAATGTGGCTTATCTGCTT
GATGAGCATCGCTCCGTACTCTCACTAAATTCCATCCTTCCATGGGCTGAGAAGGCTCGATCCTCCTTGATGCGC
AATGCGCGACTGGCCTTGATTTATTGGACCCGCTCTTCGAAGCAAGCCAACATCGACTCTTTGGTCAAGATGGGT
GACTACTACCTGTCTGGTACTGGTACACCTATCGATGCCGACAAGGCCTCGACCTGTTACCACAATGCTGCTGAA
GCCCACCACAGTGCCCAGGGCTACTGGAATTTGGGATGGATGCATGAGAATGGCGTGGCAGTAGATCAGGATTTC
CACATGGCCAAGCGATATTATGATTTGGCTCTTGACCTCAGCCCCGAAGCGTATCTGCCAGTGAAGCTCAGCTTG
ATCAAACTCCGGGCTCGAGGATACTGGAATCGCATCACTAACGGAGACATTAACCCCATCCATGAGGAGGAAGAC
TCGAAGCCCCGTCGTACCTTCAAGGAATGGGTCAAGGCTTTCATCGAGAACGACGAGGATGGCTATTACGAAGAC
CTTTATGAACTACAACGGGGTGATGATGATGAATATCGTGGCTTGGAATCCGAAGGCCACGAAGATGGCTACTAT
GATGACCTGGACCTTGATATCGACGAGGGAATGCTCGAGGGTCTCCTCATTGTCGGACTGGCTGCTGCGCTGTTG
GTTTTGGTATACTACCGTCAGCAGCAGCAGCGCAACCGACAGAACCAGAACGCCAATGCCAACGCTAACGCCAAT
GCCCCGAATGGAGATGGGAATGCCAACGACCGTGGATTATTCCCTCAGCCTGGTGAACCTGACTTTGGGCAATGG
GTAGCAGGAGGAGTTGGTCATTGA
Gene >Pro_DTO070G2_2|g5820.t1
ATGAGGACGCCGCTTTCACACTTTCTCTCGGCCCTGCGTAAGATTTGCCCGCACCTGCAGGCCCGCATCGGAAAC
TGACACCCCTTTTCAGTGCTATTGCAGACATGCGCAGCTGGGCCTGGTCAGCCGCTTACTGACCAAACAGCGTCC
GCGGCAACGGGCCGCGATGCAGACCACGAATTTACGTTCCTGGCAGGGGAAGCAGAACCCCGACCTATGACTCGT
GAGTAGAGACGACTTGTGCCTTATCGCCTGACGCTTGATACTGATTGCCTTCATCGTGATGATAGAACGAGTCGA
GAATGCCTGGAATACCCTTCGCACAATAAAGAATCCAGTCCTTCAATCCGACAAGTCGAGAGGATTACTAGGGAC
GGTCACATACTATGGCCGTCAAACGGTCCGACTGCTATTCTTGAACCGCCCTTCGACTGAAAAACCCGAGCAGAA
AATAAACAAACATCTGACGGGAGCAGTGGAGGAGCTGAGAATAGCTGCAGACGAAGACCGAGACCCGGATGCTAT
GTTCTTGTTAGCAGAGATGAACTTCTATGGCAACTTCTCCCATCCCCGCGATTTCAAAGAGGCCTTCCGCTGGTA
CCACGAACTAGCATGGTTGGACGGAAACAACACAGCGCAGAACATGGTCGGGTTCATGTATGCGACGGGCATCGG
CGGTGCGGTCGAACCCGACCAGGCAAAGGCCCTGATGTACCACGAATTTGCAGCGGAAACAGGGAACATTCGCTC
GGAGATGACACTTGCGTATCGCTACCACACTGGTATCGGAACGCCGAAGGATTGTGACCATGCGATCCATTACTA
CAAGAAGGTTGCGGACAAGGCGGTCGAGTACTACCGCTCAGGCCCTCCGGGTGGTAGGTCTATGGTTCGAGAATC
TTATCGTTGGGCAGACGAAGAAGGTGGTGTCTACGGTCCAGGAGCCAGTGTGTCGAGCTCGGGTCAAAATGCGCG
GGACGCTGCCAATGCCTCTCCTGAGGCCAGCGTGGAAGATATACTAGAATACTTGGATCTCATGTCCCGGAAGGG
TGAACTGAAGGCTACATACACCCTCGGTAAGATGAACTTCGAGGGCGCCCGGGGCTTGCCGCGGAATTTCCGACT
GGCTATGAAGCATTTCAAGGTTGTTACCAAGAAATATTGGAACAAGGATGGGTCCGTCAACTCAAACCCCCCTGC
AGGGCTTGATAAACTGGCATCCAAGGCCGCAGGACATATTGGCCTGATGTACCTTCGCGGAGAGGGTGTTAAGCA
ACACTTCCCGACTGCCCTCACATGGTTCCGGAGGGGTATTACGAACGGGGACCCGATGTGCCAGCATTGGATGGG
TCTGATGTATCTCAAGGGCTATGGTATTCCGCAGGATGCCTTCAAGGCATCTCACTACTTCAAAGCAGCGGCAGA
GCAGGATTCCCCTGCGTCAGAATCACGATTAGGCGCTCTGTTCTTGGACCAAGGAGATGTGGCAACCGCAACACG
TTACTTCGAGCTTGCCGCCCGCTGGGGCTGGATGGAGGCGTACTATTATCTAGCTGAGATGGCCAACTTCGGTAT
TGGCAGACAGCGTCACTGTGGTGTGGCCGCTGCCTACTATAAAATGGTTGCCGAAAAAGCAGAGATCGTCCACTC
AGCTTTCGTGGAGGCAAACGCTGCTTACGAAACCGGTGATAAGGAGGGCGCTCTCATTCCGTCAATGATGGCAGC
CGAGCAAGGCTATGAGAACGCACAGGCAAATGTGGCTTATCTGCTTGATGAGCATCGCTCCGTACTCTCACTAAA
TTCCATCCTTCCATGGGCTGAGAAGGCTCGATCCTCCTTGATGCGCAATGCGCGACTGGCCTTGATTTATTGGAC
CCGCTCTTCGAAGCAAGCCAACATCGACTCTTTGGTCAAGATGGGTGACTACTACCTGTCTGGTACTGGTACACC
TATCGATGCCGACAAGGCCTCGACCTGTTACCACAATGCTGCTGAAGCCCACCACAGTGCCCAGGGCTACTGGAA
TTTGGGATGGATGCATGAGAATGGCGTGGCAGTAGATCAGGATTTCCACATGGCCAAGCGATATTATGATTTGGC
TCTTGACCTCAGCCCCGAAGCGTATCTGCCAGTGAAGCTCAGCTTGATCAAACTCCGGGCTCGAGGATACTGGAA
TCGCATCACTAACGGAGACATTAACCCCATCCATGAGGAGGAAGGTAAGCTGCTCCTTCGCTCTTACCCCGTGAA
ATTAATCGCGTTCTAGTTTCTTACTTACGTTTATCACTAGACTCGAAGCCCCGTCGTACCTTCAAGGAATGGGTC
AAGGCTTTCATCGAGAACGACGAGGATGGCTATTACGAAGACCTTTATGAACTACAACGGGGTGATGATGATGAA
TATCGTGGCTTGGAATCCGAAGGCCACGAAGATGGCTACTATGATGACCTGGACCTTGATATCGACGAGGGAATG
CTCGAGGGTCTCCTCATTGTCGGACTGGCTGCTGCGCTGTTGGTTTTGGTATACTACCGTCAGCAGCAGCAGCGC
AACCGACAGAACCAGAACGCCAATGCCAACGCTAACGCCAATGCCCCGAATGGAGATGGGAATGCCAACGACCGT
GGATTATTCCCTCAGCCTGGTGAACCTGACTTTGGGCAATGGGTAGCAGGAGGAGTTGGTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail