Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5806.t1
Gene name
Locationscaffold_07:1013818..1015518
Strand-
Gene length (bp)1700
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 3.9E-140 46 507

GO

GO Term Description Terminal node
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0005509 calcium ion binding Yes
GO:0016020 membrane Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0043167 ion binding No
GO:0016787 hydrolase activity No
GO:0015923 mannosidase activity No
GO:0004559 alpha-mannosidase activity No
GO:0110165 cellular anatomical entity No
GO:0043169 cation binding No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5806.t1
MRISSLSLPLMLGLAGSSAAYPHPEPEVILPRQSDSQTKADAVKEAFQHAWNGYVKYAFPHDELHPVSNGYGDSR
NGWGASAVDALSTAIVMGNQDAVQKILDHIETIDFSKTSDQVSLFETTIRYLAGMLSGYDLLKGPASNLAPKSAQ
VDALLTQSKKLADVLKFAFDTPSGVPYNNLNISSKGNDGSTTNGLAVTGTLVLEWTRLSDLTGDDEYAKISQKAQ
SYLLNPQPSSGEPFPGLVGSNINISNGHFTDGAVTWNGGDDSFYEYLIKMFVYDPKRFESYKDRWVLAAESTIKN
LQSHPAPRPEVTWLASYNNGQYDLSSQHLTCFDGGSFILGGTVLDRQDFIDFGLQLVNGCEATYNQTLTGIGPDS
WGWDPTKVPSDQKDFYEKAGFYINSGSYDLRPEVIESFYYAYRVTGKEIYRDWVWNSFKAINATCRTDSGFAAVS
NVNTAGGGSKYDNEESFLFAEVLKYAYLVHAEDAPWQVQKGQKNSFVYNTEAHPMRVSHT*
Coding >Pro_DTO070G2_2|g5806.t1
ATGCGCATCTCCTCTCTATCACTACCTTTGATGCTGGGCCTGGCTGGGTCTTCTGCCGCCTATCCTCACCCTGAG
CCAGAGGTGATCTTGCCCCGCCAGTCGGACAGCCAGACCAAGGCCGATGCTGTCAAGGAAGCCTTCCAACATGCA
TGGAATGGATATGTCAAATATGCTTTCCCTCATGACGAGTTGCACCCCGTGAGCAATGGTTATGGTGACTCCAGG
AATGGATGGGGAGCCTCCGCTGTCGATGCGCTTTCAACCGCCATTGTCATGGGTAACCAGGATGCTGTTCAGAAG
ATCCTGGACCACATCGAGACTATTGACTTCTCGAAGACCTCGGACCAGGTCAGCCTGTTTGAGACTACTATCCGA
TATCTTGCTGGCATGTTGTCCGGCTATGATTTGCTCAAGGGTCCTGCATCCAATCTTGCCCCTAAGTCAGCTCAA
GTCGATGCCCTGCTTACCCAGTCCAAGAAACTCGCGGATGTCTTGAAGTTTGCCTTTGATACACCATCCGGTGTT
CCCTACAATAACCTTAACATCAGTTCCAAGGGAAATGATGGCTCGACCACCAATGGTCTTGCAGTAACTGGAACT
CTGGTGCTGGAGTGGACCCGGTTGTCTGATTTAACTGGCGATGATGAGTATGCCAAGATAAGCCAGAAGGCCCAG
TCGTACCTTTTGAACCCTCAGCCATCAAGCGGAGAGCCATTCCCTGGCCTGGTGGGAAGCAACATCAACATCTCC
AACGGCCATTTCACCGACGGTGCTGTCACTTGGAACGGCGGCGACGACTCGTTCTACGAGTACCTGATCAAGATG
TTCGTGTACGACCCCAAGCGGTTCGAGTCATACAAGGACCGCTGGGTCCTCGCAGCCGAGTCCACAATCAAAAAC
CTCCAGTCGCACCCCGCCCCTCGCCCGGAAGTGACTTGGTTGGCCTCATATAATAACGGCCAGTATGATCTTAGC
TCGCAGCACCTGACCTGCTTCGATGGCGGCAGTTTTATCCTGGGCGGCACCGTGCTGGATCGGCAAGACTTTATC
GATTTCGGCTTGCAGCTCGTAAATGGCTGTGAGGCTACTTACAACCAGACCCTGACCGGCATTGGACCAGACTCG
TGGGGCTGGGACCCGACGAAAGTGCCATCTGACCAAAAGGATTTCTACGAGAAGGCCGGGTTCTACATCAACAGC
GGCTCGTATGACTTGCGCCCTGAAGTGATCGAGAGTTTCTACTACGCGTACCGCGTCACAGGGAAAGAAATCTAC
CGCGACTGGGTGTGGAACAGTTTCAAGGCGATTAATGCTACCTGCCGAACTGACTCGGGCTTTGCTGCTGTGAGC
AACGTGAATACAGCTGGCGGTGGCTCAAAGTACGATAATGAGGAGAGCTTCCTCTTTGCTGAAGTCCTGAAATAT
GCATACCTTGTACATGCCGAGGATGCCCCATGGCAAGTTCAGAAGGGCCAGAAGAATTCCTTTGTGTACAATACC
GAGGCTCATCCCATGAGAGTGTCCCACACCTAG
Transcript >Pro_DTO070G2_2|g5806.t1
ATGCGCATCTCCTCTCTATCACTACCTTTGATGCTGGGCCTGGCTGGGTCTTCTGCCGCCTATCCTCACCCTGAG
CCAGAGGTGATCTTGCCCCGCCAGTCGGACAGCCAGACCAAGGCCGATGCTGTCAAGGAAGCCTTCCAACATGCA
TGGAATGGATATGTCAAATATGCTTTCCCTCATGACGAGTTGCACCCCGTGAGCAATGGTTATGGTGACTCCAGG
AATGGATGGGGAGCCTCCGCTGTCGATGCGCTTTCAACCGCCATTGTCATGGGTAACCAGGATGCTGTTCAGAAG
ATCCTGGACCACATCGAGACTATTGACTTCTCGAAGACCTCGGACCAGGTCAGCCTGTTTGAGACTACTATCCGA
TATCTTGCTGGCATGTTGTCCGGCTATGATTTGCTCAAGGGTCCTGCATCCAATCTTGCCCCTAAGTCAGCTCAA
GTCGATGCCCTGCTTACCCAGTCCAAGAAACTCGCGGATGTCTTGAAGTTTGCCTTTGATACACCATCCGGTGTT
CCCTACAATAACCTTAACATCAGTTCCAAGGGAAATGATGGCTCGACCACCAATGGTCTTGCAGTAACTGGAACT
CTGGTGCTGGAGTGGACCCGGTTGTCTGATTTAACTGGCGATGATGAGTATGCCAAGATAAGCCAGAAGGCCCAG
TCGTACCTTTTGAACCCTCAGCCATCAAGCGGAGAGCCATTCCCTGGCCTGGTGGGAAGCAACATCAACATCTCC
AACGGCCATTTCACCGACGGTGCTGTCACTTGGAACGGCGGCGACGACTCGTTCTACGAGTACCTGATCAAGATG
TTCGTGTACGACCCCAAGCGGTTCGAGTCATACAAGGACCGCTGGGTCCTCGCAGCCGAGTCCACAATCAAAAAC
CTCCAGTCGCACCCCGCCCCTCGCCCGGAAGTGACTTGGTTGGCCTCATATAATAACGGCCAGTATGATCTTAGC
TCGCAGCACCTGACCTGCTTCGATGGCGGCAGTTTTATCCTGGGCGGCACCGTGCTGGATCGGCAAGACTTTATC
GATTTCGGCTTGCAGCTCGTAAATGGCTGTGAGGCTACTTACAACCAGACCCTGACCGGCATTGGACCAGACTCG
TGGGGCTGGGACCCGACGAAAGTGCCATCTGACCAAAAGGATTTCTACGAGAAGGCCGGGTTCTACATCAACAGC
GGCTCGTATGACTTGCGCCCTGAAGTGATCGAGAGTTTCTACTACGCGTACCGCGTCACAGGGAAAGAAATCTAC
CGCGACTGGGTGTGGAACAGTTTCAAGGCGATTAATGCTACCTGCCGAACTGACTCGGGCTTTGCTGCTGTGAGC
AACGTGAATACAGCTGGCGGTGGCTCAAAGTACGATAATGAGGAGAGCTTCCTCTTTGCTGAAGTCCTGAAATAT
GCATACCTTGTACATGCCGAGGATGCCCCATGGCAAGTTCAGAAGGGCCAGAAGAATTCCTTTGTGTACAATACC
GAGGCTCATCCCATGAGAGTGTCCCACACCTAG
Gene >Pro_DTO070G2_2|g5806.t1
ATGCGCATCTCCTCTCTATCACTACCTTTGATGCTGGGCCTGGCTGGGTCTTCTGCCGCCTATCCTCACCCTGAG
CCAGAGGTGATCTTGCCCCGCCAGTCGGACAGCCAGACCAAGGCCGATGCTGTCAAGGAAGCCTTCCAACATGCA
TGGAATGGATATGTCAAATATGCTTTCCCTCATGACGAGTTGCACCCCGTGAGCAATGGTTATGGTGACTCCAGG
TGAACATGTCCGATTATCCAGTTCTTGCTGTGAAACTGACACGCGATAGGAATGGATGGGGAGCCTCCGCTGTCG
ATGCGCTTTCAACCGCCATTGTCATGGGTAACCAGGATGCTGTTCAGAAGATCCTGGACCACATCGAGACTATTG
ACTTCTCGAAGACCTCGGACCAGGTCAGCCTGTTTGAGACTACTATCCGATATCTTGCTGGCATGTTGTCCGGCT
ATGATTTGCTCAAGGGTCCTGCATCCAATCTTGCCCCTAAGTCAGCTCAAGTCGATGCCCTGCTTACCCAGTCCA
AGAAACTCGCGGATGTCTTGAAGTTTGCCTTTGATACACCATCCGGTGTTCCCTACAATAACCTTAACATCAGTT
CCAAGGGAAATGATGGCTCGACCACCAATGGTCTTGCAGTAACTGGAACTCTGGTGCTGGAGTGGACCCGGTTGT
CTGATTTAACTGGCGATGATGAGTATGCCAAGATAAGCCAGAAGGCCCAGTCGTACCTTTTGAACCCTCAGCCAT
CAAGCGGAGAGCCATTCCCTGGCCTGGTGGGAAGCAACATCAACATCTCCAACGGCCATTTCACCGACGGTGCTG
TCACTTGGAACGGCGGCGACGACTCGTTCTACGAGTACCTGATCAAGATGTTCGTGTACGACCCCAAGCGGTTCG
AGTCATACAAGGACCGCTGGGTCCTCGCAGCCGAGTCCACAATCAAAAACCTCCAGTCGCACCCCGCCCCTCGCC
CGGAAGTGACTTGGTTGGCCTCATATAATAACGGCCAGTATGATCTTAGCTCGCAGCACCTGACCTGCTTCGATG
GCGGCAGTTTTATCCTGGGCGGCACCGTGCTGGATCGGCAAGACTTTATCGATTTCGGCTTGCAGCTCGTAAATG
GCTGTGAGGCTACTTACAACCAGACCCTGACCGGCATTGGACCAGACTCGTGGGGCTGGGACCCGACGAAAGTGC
CATCTGACCAAAAGGATTTCTACGAGAAGGCCGGGTTCTACATCAACAGCGGCTCGTATGACTTGCGCCCTGAAG
TGATCGAGAGTTTCTACTACGCGTACCGCGTCACAGGGAAAGAAATCGTGGGTCATTCTCCCTTCCACTGATGTT
CTAATATACTGACTCATATAGTACCGCGACTGGGTGTGGAACAGTTTCAAGGCGATTAATGCTACCTGCCGAACT
GACTCGGGCTTTGCTGCTGTGAGCAACGTGAATACAGCTGGCGGTGGCTCAAAGTACGATAATGAGGAGAGCTTC
CTCTTTGCTGAAGTCCTGAAATATGCATACCTTGTACATGCCGAGGGTAAGTTGCTAGTCTTCCCAGTCACCCTT
CTTTTTTTCAAACATTGCTAATCCTGGGTTCTGGTATAGATGCCCCATGGCAAGTTCAGAAGGGCCAGAAGAATT
CCTTTGTGTACAATACCGAGGCTCATCCCATGAGAGTGTCCCACACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail